KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003338Help
Entry
CpipJ_CPIJ003338  CDS       T01079                                 

Definition
beta-galactosidase
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CpipJ_CPIJ003338
  Lipid metabolism
   00600 Sphingolipid metabolism
    CpipJ_CPIJ003338
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    CpipJ_CPIJ003338
   00604 Glycosphingolipid biosynthesis - ganglio series
    CpipJ_CPIJ003338
   00511 Other glycan degradation
    CpipJ_CPIJ003338
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    CpipJ_CPIJ003338
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CpipJ_CPIJ003338
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CpipJ_CPIJ003338
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 650 aa AA seqDB search
MCPTWVDEPQHDASDVQITPDAQDLFDLKNEERSFYIDYDRDTFVMDGKDFRYVSGSFHY
FRALPQTWRSKLRTMRAGGLNAVDLYVQWSLHNPKDNQYVWDGIANITDVIEAAIEEDLY
VILRPGPYICAEIDNGGLPYWLFNKYPGIQVRISDANYIKEVKIWYEKLMSQLTPYMYGN
GGPIIMVQLENEYGAFGKCDKQYLNVLKEETEKYTQGKAVLFTVDRPYDDELVCGQIPGV
FITTDFGLMTDDEVDTHAAKVRSIQPKGPLVNTEFYTGWLTHWQEKNQRRPAGPLAATLR
KMLKDGWNVDFYMYFGGTNFGFWAGANDWGLGKYMADITSYDYDAPMDEAGDPSMKYTIF
RDIIGEYIPLPAVRVPDRAPKMKHEPVLLSSVESILSTSSRNLLGTPALKSDKLLTFEEL
NQNSGFVLYETTLPKFTRDPSLLTINDLRDRAQIYVDEFYLGTLSRENAISSLPISAGWG
SKLSILVENQGRINFDVLDDYKGILGNVTIQIYDEPYTQELSDWTITGYPFDSYDKFTQL
FATLNEGAGHGVNGKGAAIHGPVTFKGELVIETSEIHDTYFDMTGWGKGFIFINGFNLGR
YWPVAGPQVTMYLPKELLKSGANEIVLVELQKAPTDKMVHFADSAILDEA
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcctacctgggtcgacgagccgcagcatgacgcctccgatgtgcagatcaccccg
gacgcgcaggatcttttcgacctgaagaatgaagaacgctcgttctacattgactacgat
cgggataccttcgtgatggatggaaaggactttcgctatgtttcgggttcttttcattat
ttcagagctctgccccagacatggcgatcgaagctgcgaaccatgcgcgccggagggctc
aatgccgtcgacctgtacgtgcagtggtcactgcacaatcccaaggacaatcagtacgta
tgggacggtattgccaacatcacggacgtcattgaggccgccatcgaggaagacttgtac
gtaattttgaggcctgggccttatatttgtgcggagattgataatggtggcctgccatac
tggttattcaacaaatacccaggaattcaagtcagaatcagtgatgccaactacatcaaa
gaagtgaaaatttggtatgaaaagcttatgtcccagctgacaccctacatgtacggcaac
ggtggtcccatcatcatggttcagctcgagaatgagtacggagcattcggaaagtgtgat
aaacaatatcttaacgttctgaaagaggaaacggaaaaatatacccaaggaaaggccgtt
ctgttcactgtggacaggccttacgacgatgagctagtgtgcggacaaattcccggagtg
ttcatcactaccgattttggactgatgacggacgacgaggtcgacacccatgcggccaag
gttcgctcaatccagccaaagggtcctctggtcaataccgaattctatacaggttggttg
acgcactggcaagagaagaaccagcgacgtcctgcaggcccgttagctgctactttgcgt
aagatgctcaaggatggatggaatgttgacttttacatgtactttggaggaacaaacttt
ggcttttgggctggtgcaaacgactggggtctgggcaagtacatggccgacatcacctcg
tatgactatgacgctcctatggacgaagctggagatccttcgatgaagtataccatcttc
agagatatcatcggggagtacatcccacttcccgctgttcgagtgccagaccgtgcccca
aagatgaaacacgaaccggtgttgttgtcaagcgtagaaagcatcctgagcaccagctcc
agaaatcttctcgggacacccgctcttaagtccgataaattgcttacctttgaggaattg
aatcaaaattctggatttgtcctctacgaaacaacgctgcccaaattcacacgtgatcca
agcctgctgaccatcaacgatttacgtgacagagctcaaatttatgtcgatgagttttat
ctgggcaccctatctagagaaaacgcaatcagcagcttaccaatatcggccggttggggt
agcaagctctctatcctggtagaaaatcaaggtcgcatcaactttgatgttctcgacgac
tacaagggaatcctcggcaatgttaccattcaaatctacgacgagccgtacacgcaggag
ctgtccgattggaccatcaccggttatccgttcgacagctacgacaaattcacgcaactg
tttgccaccttaaacgagggagcaggacacggcgtgaatggaaagggagccgcaattcac
ggtccagtgacattcaagggggaacttgtcatcgagacgagcgagatccacgatacctat
ttcgacatgactggttggggaaagggtttcatctttatcaacggattcaacctgggaaga
tactggcccgtggcgggtccccaggtgaccatgtaccttccgaaggagctgctcaagtcc
ggtgcgaatgaaatcgtgcttgttgagctgcagaaggctcccaccgataaaatggttcac
tttgccgatagtgccattttggatgaagcttaa

DBGET integrated database retrieval system