KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003338Help
Entry
CpipJ_CPIJ003338  CDS       T01079                                 

Definition
beta-galactosidase
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cqu00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cqu00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:cqu00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:cqu00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cqu00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:cqu04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 650 aa AA seqDB search
MCPTWVDEPQHDASDVQITPDAQDLFDLKNEERSFYIDYDRDTFVMDGKDFRYVSGSFHY
FRALPQTWRSKLRTMRAGGLNAVDLYVQWSLHNPKDNQYVWDGIANITDVIEAAIEEDLY
VILRPGPYICAEIDNGGLPYWLFNKYPGIQVRISDANYIKEVKIWYEKLMSQLTPYMYGN
GGPIIMVQLENEYGAFGKCDKQYLNVLKEETEKYTQGKAVLFTVDRPYDDELVCGQIPGV
FITTDFGLMTDDEVDTHAAKVRSIQPKGPLVNTEFYTGWLTHWQEKNQRRPAGPLAATLR
KMLKDGWNVDFYMYFGGTNFGFWAGANDWGLGKYMADITSYDYDAPMDEAGDPSMKYTIF
RDIIGEYIPLPAVRVPDRAPKMKHEPVLLSSVESILSTSSRNLLGTPALKSDKLLTFEEL
NQNSGFVLYETTLPKFTRDPSLLTINDLRDRAQIYVDEFYLGTLSRENAISSLPISAGWG
SKLSILVENQGRINFDVLDDYKGILGNVTIQIYDEPYTQELSDWTITGYPFDSYDKFTQL
FATLNEGAGHGVNGKGAAIHGPVTFKGELVIETSEIHDTYFDMTGWGKGFIFINGFNLGR
YWPVAGPQVTMYLPKELLKSGANEIVLVELQKAPTDKMVHFADSAILDEA
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcctacctgggtcgacgagccgcagcatgacgcctccgatgtgcagatcaccccg
gacgcgcaggatcttttcgacctgaagaatgaagaacgctcgttctacattgactacgat
cgggataccttcgtgatggatggaaaggactttcgctatgtttcgggttcttttcattat
ttcagagctctgccccagacatggcgatcgaagctgcgaaccatgcgcgccggagggctc
aatgccgtcgacctgtacgtgcagtggtcactgcacaatcccaaggacaatcagtacgta
tgggacggtattgccaacatcacggacgtcattgaggccgccatcgaggaagacttgtac
gtaattttgaggcctgggccttatatttgtgcggagattgataatggtggcctgccatac
tggttattcaacaaatacccaggaattcaagtcagaatcagtgatgccaactacatcaaa
gaagtgaaaatttggtatgaaaagcttatgtcccagctgacaccctacatgtacggcaac
ggtggtcccatcatcatggttcagctcgagaatgagtacggagcattcggaaagtgtgat
aaacaatatcttaacgttctgaaagaggaaacggaaaaatatacccaaggaaaggccgtt
ctgttcactgtggacaggccttacgacgatgagctagtgtgcggacaaattcccggagtg
ttcatcactaccgattttggactgatgacggacgacgaggtcgacacccatgcggccaag
gttcgctcaatccagccaaagggtcctctggtcaataccgaattctatacaggttggttg
acgcactggcaagagaagaaccagcgacgtcctgcaggcccgttagctgctactttgcgt
aagatgctcaaggatggatggaatgttgacttttacatgtactttggaggaacaaacttt
ggcttttgggctggtgcaaacgactggggtctgggcaagtacatggccgacatcacctcg
tatgactatgacgctcctatggacgaagctggagatccttcgatgaagtataccatcttc
agagatatcatcggggagtacatcccacttcccgctgttcgagtgccagaccgtgcccca
aagatgaaacacgaaccggtgttgttgtcaagcgtagaaagcatcctgagcaccagctcc
agaaatcttctcgggacacccgctcttaagtccgataaattgcttacctttgaggaattg
aatcaaaattctggatttgtcctctacgaaacaacgctgcccaaattcacacgtgatcca
agcctgctgaccatcaacgatttacgtgacagagctcaaatttatgtcgatgagttttat
ctgggcaccctatctagagaaaacgcaatcagcagcttaccaatatcggccggttggggt
agcaagctctctatcctggtagaaaatcaaggtcgcatcaactttgatgttctcgacgac
tacaagggaatcctcggcaatgttaccattcaaatctacgacgagccgtacacgcaggag
ctgtccgattggaccatcaccggttatccgttcgacagctacgacaaattcacgcaactg
tttgccaccttaaacgagggagcaggacacggcgtgaatggaaagggagccgcaattcac
ggtccagtgacattcaagggggaacttgtcatcgagacgagcgagatccacgatacctat
ttcgacatgactggttggggaaagggtttcatctttatcaacggattcaacctgggaaga
tactggcccgtggcgggtccccaggtgaccatgtaccttccgaaggagctgctcaagtcc
ggtgcgaatgaaatcgtgcttgttgagctgcagaaggctcccaccgataaaatggttcac
tttgccgatagtgccattttggatgaagcttaa

DBGET integrated database retrieval system