KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003456Help
Entry
CpipJ_CPIJ003456  CDS       T01079                                 

Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Module
Purine degradation, xanthine => urea
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CpipJ_CPIJ003456
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    CpipJ_CPIJ003456
Enzymes [BR:cqu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     CpipJ_CPIJ003456
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 326 aa AA seqDB search
MMSRKLVADEATGAADRDIPEEFRISNYGYGKDSVKVMHVVRNGLVHSIKEFEVGTKLKL
ASQKDYLQGDNSDIVATDSQKNTVYLLARKHGLKSPEEFGILLCNHFLTKYSHVNEVSIH
IEEYPWSRMGFGKGPYQALHNHAFVFTPTATRYCDVTQKRSESTPTVISGLTDLRVLKTT
QSAFVNFVNDEYRSLPDQHDRIFSTVVRSSWQYSTVANVDFDFCWNKVKHCILDTFAGET
EKGVFSPSVQNTLYLAEKLVLEHIPEVSSIDMTMPNKHYFNFDFSKFPKLINGDEMKEET
VFLPVDKPSGIIYAQLDRKSTIKSKL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccagaaagttggtagcggatgaagcgacaggcgcagccgaccgtgacattccg
gaagagttccgcattagcaactacggctacggcaaggacagcgtcaaggtgatgcacgtg
gtccgcaacgggctggttcacagtattaaggagttcgaggtgggcaccaagctgaagctg
gccagccaaaaggactacctccagggtgacaactcggacatcgttgccacagattctcaa
aagaacacggtctacctgctagcgcgcaaacacggactcaaatcaccggaggagtttggc
atcctgttgtgcaaccacttcctgaccaaatactcccacgtcaacgaggtgtcgatccac
atcgaagagtacccgtggtctcggatgggcttcggcaaaggaccctaccaggcccttcac
aaccatgccttcgtgttcacgccgactgccacgcggtactgtgacgtcacccagaagcga
agtgaatcaaccccaaccgtcatcagcggtctaaccgacctgcgcgtgctcaaaaccacc
caatccgcgttcgtcaacttcgtaaatgacgagtatcggtccctgcccgatcaacacgat
cgcatcttcagcacggtcgtgcgctcgtcctggcagtactccaccgtcgccaacgtggac
tttgacttttgctggaacaaggtcaagcactgcatcctggacacgtttgccggcgaaacg
gaaaagggtgtgttctcgccgagcgtccagaacacgctgtacctcgcggaaaagctggtc
ctcgagcacatccccgaagtgtcctcgatcgatatgacgatgccgaacaagcactacttt
aactttgacttcagcaagtttcccaagctgatcaacggggacgagatgaaggaggaaacg
gtgttcctgccggtggacaagccatcggggatcatttacgcccagctggaccggaagtcg
acgataaagagcaaactttga

DBGET integrated database retrieval system