KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003524Help
Entry
CpipJ_CPIJ003524  CDS       T01079                                 

Definition
annulin
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     CpipJ_CPIJ003524
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 734 aa AA seqDB search
MEHSPSSDVLTIKSVDLCIEENGKSHHTKRYELMTRDGQYGAPAALVIRRGQAFRLRLTC
DRPFDRSRDAMSLIFTVDQDERPTHGHGSLVGVALQQYRHMIEDPLEWAAAIDFVSGDVL
EILVKPAANALVTKWKLDFDTKLLSEGFGKSYSLPQPFYLLFNPWCKDDQVYLEDKALRD
ECVMNDTTLIWRGSYNRLRPSVWKFGQFDKHVLDCALLLIAKVGKVSATHRGDPILVCRA
ISAAVNSPDDDGALLGNWSGDFSGGIAPTKWVGSVEILQQFYKKQKPVKFAQCWVFAGVV
STIARAIGIPSRVITNYSSAHDTQASLTVDYFVDKNGKIMEEMNSDSIWNYHVWNEVWMQ
RPDLGIGSDGDYGGWQAIDATPQEMSDGMFRCGPASVLAVKLGEIAKPYDNNFLFAEVNA
DKVFWRYTGPAHPLKLIRKDVFGIGHFISTKAVGKWEREDVTSSYKFAEKSQEERDTMLK
ALKQANSAFSRYYLNEDFNEVYFNFELRDDIKIGEAFSVILQIKNRSSETPHTINGYLNV
ETVLYTGKQREFVKKHPFTVNLDPASEEFIRMEVSFDEYYKKLRDQAAFNISCFATVENT
DYEFFAQDDFRVRKPDIKIKLADTPVSQSPVEVTIALLNPLPIPLRKGIFHVEGSGIEKP
LIFKHPEVAVDETINNIFVLTPPFAGRGTIAAKFTSRELDDVDGFVAFEAKPRSEDVLME
TSDNEVIERTDIID
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggaacattctccgtcttcggatgtgctcaccatcaaatcggtggatctttgtatcgag
gaaaatggaaaatcccaccacaccaaacgctacgagttgatgacccgcgatggtcagtac
ggagccccggcagctttggtgatccgaaggggtcaagcgtttcggttgcggcttacgtgc
gatcgtccgttcgatcgaagtcgcgacgcgatgagtttgatcttcaccgtcgatcaggac
gagcggccaacgcacggccatggctcgctggtgggagtggcgctgcagcagtaccggcac
atgatcgaagatccgctggagtgggctgcggcgatcgatttcgtcagcggcgacgtgctg
gagatcttggtgaagccggcggcgaacgcgttggtcaccaagtggaagttggactttgac
acgaagctgctgagtgaggggttcgggaagagttactcgctgccgcagccgttttacttg
ctgtttaatccgtggtgcaaggacgaccaggtgtatctggaagacaaggcccttcgggac
gagtgcgtcatgaacgataccactttgatctggagaggttcgtacaaccggctgcgtcct
tcggtctggaagtttggccagtttgacaaacacgtgctggattgtgcgctgctgttgatc
gcgaaggtgggcaaggtaagtgcaacccatcggggtgatccgattctggtgtgccgtgcc
atatcggccgcggtcaattctccggatgacgacggagcactgctgggcaattggagtgga
gacttttccggcgggatcgctccgaccaagtgggtcggctcggttgagattctgcagcag
ttttacaagaagcaaaagccggtgaagtttgcacagtgctgggtgtttgccggggtcgtt
tcgacaattgcacgagcgatcggaattccgtcgcgagtgatcaccaactactcgtcggcg
catgacacgcaagcttcgctcaccgtggattatttcgttgacaaaaatggtaaaattatg
gaggaaatgaactcggactcgatttggaactaccacgtgtggaacgaggtctggatgcag
cggccggacttgggtattggttcggacggggactacggaggctggcaggcgatcgatgct
acgccgcaggaaatgtctgacgggatgttccgttgtgggccggcttcggtgttggctgtc
aagttgggtgagatcgccaagccgtacgataacaactttttgtttgcggaggtcaacgcc
gataaggtgttttggaggtacactggtccggctcatccacttaagttgattcggaaggat
gtttttgggattggacattttattagtacgaaggccgttggcaagtgggagcgagaagat
gtcacaagtagctacaaatttgctgaaaaatcacaggaagaacgagacacgatgttgaag
gcgctgaagcaggcaaacagtgcctttagcagatactatctgaacgaggacttcaacgaa
gtctatttcaactttgaactgagggatgatatcaagattggggaagcattttcagtgatc
cttcaaatcaagaaccgatcgtcggaaacccctcacacaataaacggctacctgaacgtc
gaaacagtattgtacaccggcaagcagcgagagttcgtcaaaaagcatcccttcaccgtc
aacttggatcccgcctccgaggaattcatccgcatggaggtctccttcgacgagtattac
aaaaagctgcgcgatcaagccgcgttcaacatttcgtgcttcgccacggttgaaaacact
gattacgaattcttcgcccaggatgacttccgcgtgcgcaaaccggacattaaaattaaa
ctcgccgacacgccggtctcgcagagtccggtggaggtgacgattgcactgctgaaccca
ctgccaattccgctgaggaagggaatcttccacgtcgaggggtcgggcattgagaagccg
ctgattttcaagcacccggaagtcgccgttgacgagacgatcaacaatattttcgtgctg
actccaccgtttgctggacggggaacgatcgctgccaagttcacctccagggagctggac
gacgtggatggctttgtggcgtttgaggctaaaccgcgatcagaggatgtcctcatggag
accagtgacaacgaagtcatcgaacggacggatataatcgattga

DBGET integrated database retrieval system