KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003655Help
Entry
CpipJ_CPIJ003655  CDS       T01079                                 

Definition
pap-inositol-1,4-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CpipJ_CPIJ003655
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CpipJ_CPIJ003655
Transfer RNA biogenesis [BR:cqu03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CpipJ_CPIJ003655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 311 aa AA seqDB search
MATSTVVAPLVMRIVASSIQIANRAGRIIRDVLAKGDLGIVEKDGKDDLQTEADRSAQRC
IVASLEKLFPNVTIIGEEGACDTRVPEDWLVSDVNGEFLAGNACPDALKQVKESELVIWV
DPLDGTSEYTQGFLERVTVLIGISVNDRAVGGVIHQPFFQTDSGTQGRTIWGVKGIGAGG
FIPTRPPTDRFIVTTTRSHSNALVQSALDALAPDEVLRVGGAGYKVLQLLEGKAHAYVFA
SAGCKKWDTCAPEAVLEAQGGKLTDILGRHYSYGKEVSFPNACGVLGTASGISHEDILAK
LPDSVKQAMNK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggccacttcgacggtagttgccccgctcgtgatgcggatcgtggccagctcgatccag
atcgcgaaccgtgccgggcggatcatccgggacgtgctggccaagggcgatctgggaatc
gtggagaaggacggcaaggacgacctgcagacggaggcggaccggtcggcgcagcgctgc
atcgtggcctcgctggagaagctgttcccgaacgtgaccataattggcgaggagggagct
tgtgatacgcgcgttccggaggattggctggtgtcggatgttaatggggagtttttggcg
gggaacgcttgcccggacgcgttgaagcaggtcaaggagagtgagttggtcatttgggtg
gacccgttggatgggacgagcgagtacacgcaagggtttttggagcgtgttacggtgttg
atcgggatttcggtgaatgatcgtgcggttggaggagtgattcatcagccgttcttccag
acggacagtgggacgcagggacggaccatttggggagtgaaggggattggagctggtggg
ttcattccgacgcgaccgcctacggacaggttcatcgtgactacgactcgatcacattcc
aacgcactggttcagtcggcactggacgcgctggccccggatgaggttttgcgggttggt
ggcgctgggtacaaggtactgcagctgctggaggggaaggctcacgcgtacgtgtttgcc
agtgccggctgtaagaagtgggacacgtgcgcaccggaagcggttttggaggcgcaaggg
ggaaagttgaccgacatcctaggtcggcactattcgtacgggaaggaggtaagttttcca
aacgcttgtggagtactggggacggccagtggaatatcgcacgaggatattctggccaag
cttccagacagcgtgaagcaagcaatgaataagtaa

DBGET integrated database retrieval system