KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003755Help
Entry
CpipJ_CPIJ003755  CDS       T01079                                 

Definition
nuclear pore complex protein Nup205
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:cqu03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1972 aa AA seqDB search
MSEATPDDMWTPFKHLFNSIESFLVTPAGGAGQQQEQNVASLDALLRKHKQNFSTLLRNP
PKNGKSREAIRQGITEGITLPEFGHTILSKDLVDESVILSDMYDLNELIVLELLCTAQQQ
MPNHPGLPRGLVAVLLYYDGRKSLVASLKELFQARAGVSWCTDAPQEITQLITAYTDGLV
ADGLLDKIVDLLGELDVTKELDVLTTNRALGPPKHHRQVLDLFEEIRVLLATCLFNWAAQ
CGLPKGTTVKLIRHLAKYKSTVSSGGIDNVTLALQMALMYALDMSVIQRREDGEDVVKRL
PMVRDGEFIETVMETLSASWECEGLRSVSLFTFGLAIATLRLAPQNMYSNTARIIDQDEL
LVDAAIQGRVFDFIHYTLLENEVLFRTEFYYRRMHVLFTDFIELMHSKVTELRARADETA
RTVQAFQQQGLDPPANLCRNFEALLLSVGKLYANDPMHLSLSLEYWGPMEVAANYQRASS
RSVCLFKFIRLAGELLPPILFIPYLKMLAGLSSSPQSARNAFNLLKQGSGGGIGGAAATI
SWDHFFNSLFRYYQNLRQEQNPGSETVYRSRALSRNINPQEIAGLQAVLLVIRAVATYDE
VARVALCEHPNWAPLHVLLGLISCSVPIALKAELVQTLAALGKSKETALQLWNNLEASQV
IATIPTTSTFVNRGIESELEEIESRNETYPLALGMLDLLYTLCETAIPKGIGAGPRKPGL
DPYVTFIIDAVFLRFYNRNYKNPAEKWQIAEKCLQLLHAFVRNYTPSPQDFPSPTAVREE
NSPPGFHILLQVNTKSDFLRLLLHIIDESCTLFDSYTPFPGRKHLEATSLYALQILERAL
ETQEDFFNAHFTSNCSILLAGANKLLLGLNPRSGKADHMLNVTRFVTYSSWLPENALVAI
RILAAIMRQPNVNQQILGLFTQNERITNEIRQGFVECLESERVSEFQQQDDELDEFSGGG
GGSSVELLIKEAIVALLADCLPQQATPNLAHYLLGFELNKELRLTNLQQPGVLNFPSNCA
KSLITLLDGALEQSKSGKALAPAHERLVENAYALLYTLCYNSRTSEVILRFLRSCNDFLC
RHIQGLPFANVASPHVLNQMTGLLKCVSQFGNLCKILLGVVQRDRDNQQQNQIDEMSQHH
QYSTTFNGSMLSASMVGGDAPKSASSAAESAKLLLCQLLDCLNFEIKSLEKPKWDYFDNA
VLVGLFQSCELAVAGGLKLVDIKRMHDVLKDELNSVQTTIAAGQRAHILAEIESILVYAL
QVNSQRNLCASTVRFLEAWGQVTEVLFSVTPAMFVSLDVKKGLLVEIVQAVLGKVVPNQT
MPELANLASSSVLLLMVNLRHCYSLKNSGQEGVQGASLVAGSFSGQVGGMFSPKTNTLSL
RYILQNILEWILISGVGSQKLRINLYAALLNYMHIVKGNRDQSEKEQADGGGVSPRDEFY
VSRLDKSLGKALDGTTHGTSDESHAQIEMVIEIFQSFGDKLIDILCHDCTGGHDICKMLA
LSCIDMLLDMDSLASVIQFISKRGYLAHLIDSLLKSDGRLCRILDKQPENMKALYVYESK
LAMLSRIGGSHIGAELLLEEKALSVLAGMKVFDLHPDFQVVTYSSHSQPSSSFIPPIDAR
YRQILFPALNLCDVILSTLGQENHSAVTQIIHFLLSHGDTIEIVLRAGTPFLDLGLLQEL
AGITSLIARAANQEIYNLITPNANQDLRAHLHRLQKLMLTLLPRFTLSEQTLKELNQTIL
THSTERERSAHLRYILQIAANLALYARNSISNHAVDHRTISVLFSPQIGESHQGQGETAS
HSLNIVVVQLKHSVEYYNRERLSLESMLRQRNSLPSLSLDTNVQIQHNNLTERLSSKQEE
LKRCVFITEHCLYLLWAHLDFFMLRAIPVSTLHFNNVSYGADNYLSAQTEVGWKITAEDV
ATLKKSLIAVFNETFCKQLLATAQDHARASDKGFIEALLRRIKRLIQFVPVK
NT seq 5919 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaagccactccggacgatatgtggacgccgttcaagcatctgttcaacagcatc
gagagcttcctggtgacacccgccggcggcgccggtcaacagcaggagcagaatgtggcc
agcttggacgcgctgctgcggaagcacaagcaaaactttagcactttgctgcggaatccg
cccaagaatggcaagagtcgggaggctattcggcaggggatcacggaggggattacgttg
ccggagtttggacatacgattctgtcgaaggacttggtggatgagagcgtgattttgtcg
gatatgtacgacttgaacgagttgatcgtgctggagttgttgtgtacggcgcagcagcag
atgccgaaccatccggggttgccgcgggggttggtggcggtgttgctgtactatgacggg
cgtaagtcgctggtggcgtcgttgaaggagctgtttcaggcgcgggcgggggtgagttgg
tgcacggacgcgccgcaggagattacgcagctgattacggcttacacggacgggttggtg
gcggatgggttgctggataagattgtggatttgctgggggagctggacgtgacgaaggag
ttggacgtgctgacgacgaatcgggcgttggggccgccgaagcatcaccggcaggtgttg
gatttgtttgaggagattcgggttttgttggcgacctgtttgttcaattgggcggctcag
tgtggactgccgaagggcacgacggtgaagttgattcgtcatttggccaagtacaagtcg
acggtgagttcgggggggattgacaatgtaacgctggcgctgcagatggcgttgatgtac
gcgctggacatgagcgtgattcagcggcgggaggatggtgaggacgtggtgaagcggttg
ccgatggttcgggatggggagtttattgagacggtcatggagacgctgtcggcgagctgg
gagtgcgaaggactgcggtcggtttcgttgtttacgttcgggttggcgattgcgacgctg
agattggctccgcagaatatgtactcgaacacggcccggatcatcgaccaggatgaactg
ctggtggacgcggctattcagggacgggtgtttgactttatccattacacgctgctggag
aacgaagtgttgtttaggacggagttttactaccgtcgcatgcacgtcctcttcacggat
ttcatcgagttgatgcactccaaggtgacggaacttcgtgcgagggcggatgagacggcg
agaaccgtgcaagccttccagcagcagggcctggatccacctgcgaacctctgtcggaac
tttgaagcgttgcttctgtccgtggggaagctctacgccaacgatccgatgcatctctcg
ttgtccctcgagtactggggaccgatggaagtggccgccaactatcagcgcgcatcgtcc
cgctccgtgtgcctgttcaagtttatccgactggcaggagagttgctgccaccgattctg
ttcattccgtatctgaagatgctcgccggcctgtccagctcgccgcaatccgctcggaat
gcgttcaatctgctgaagcagggaagcggaggtggcattggaggcgcggctgccaccatc
tcgtgggaccactttttcaactcgctgttccgttactaccagaatctacgccaggagcag
aaccccggttccgagacggtttaccgcagtcgagccttgagcaggaacatcaacccgcag
gagattgctggtttgcaagcggtcctgctggtgatccgtgccgtggccacctacgacgaa
gtggcgcgtgttgcgctctgcgagcacccgaactgggcgccactccacgtcctgctcggc
ctcatcagctgctccgtcccgatcgccctgaaagccgaactcgtccaaacgctggccgcc
ctcggcaaatccaaagaaaccgccctccaactgtggaacaacctggaggcgtcccaggtc
atcgcgaccatccccaccacaagcaccttcgtcaaccgcggcatcgagtccgagctggaa
gagatcgaaagccgcaacgaaacctacccgctggccctcggcatgctggacctgctctac
accctgtgcgaaacggccatcccgaagggcatcggcgccggtccccgcaaacccggcctc
gacccgtacgtcaccttcatcatcgacgccgtcttcctgcgcttctacaaccgcaactac
aaaaaccccgccgagaagtggcaaatcgcagaaaagtgtctccagctactgcacgccttc
gtccgcaactacaccccctccccgcaggacttcccctcgccaaccgccgtccgcgaagaa
aactccccgcccggcttccacatcctgctccaggtcaacaccaagtccgacttcctccgt
ctcctcctgcacatcatcgacgaatcctgcaccctgttcgacagctacacgcccttcccc
ggccggaagcacctggaagcgacctccctctacgccctccaaatcctcgaacgcgccctc
gaaacccaggaagacttcttcaacgcgcacttcacctccaactgctcgatcctgctggcc
ggcgccaacaagctgctgctcgggttgaacccccgctccggcaaggccgaccacatgctc
aacgtcacgcgcttcgtcacgtacagctcgtggctgccggagaacgcactcgtcgcgatc
cggatcctcgcggcgatcatgcgccagcccaacgtgaaccagcagatcttgggactattt
acgcagaacgagcgcatcacgaacgagatccggcaggggttcgtggagtgcttggagagc
gagcgggtcagcgagttccagcagcaggacgacgagctggacgagttttccggtggtggt
ggcggatcgagcgtggagttgttgatcaaggaggcgatcgtggcgttgctggcggattgc
ttgccgcagcaggcgacgccgaacttggcgcactacctgcttgggttcgagctgaacaaa
gaacttcgattgacgaacttacaacagccgggcgtcctcaacttccccagcaactgcgcc
aaatcgctgatcacgctgctggacggcgcgctcgagcagtccaaatccggcaaggcgctt
gcgcccgcccacgaacgcctcgtcgagaacgcgtacgcgttgctttacaccctgtgctac
aacagtcgcacttcggaggtcattctgcgcttcctgcgcagctgcaacgactttctgtgt
cgtcacatccagggtctgccgttcgcgaacgtcgcaagcccgcacgtgttgaaccagatg
acgggcctgctgaagtgcgtgtcgcagtttgggaacctgtgcaagatcctgctgggggtg
gtgcagcgcgatcgagacaatcagcagcagaatcagatcgacgagatgtcccagcaccat
cagtacagtacgactttcaacgggagcatgctgtcggcttcaatggtggggggagacgcg
cccaagtcggcgtcgtcggcggcggagtcggcgaagctactgctctgtcagctgctggac
tgtttgaactttgagatcaagtcgctggagaagcccaagtgggactactttgacaacgcg
gtactggtggggctgttccagagctgtgagttggcggtggcggggggtttgaagttggtg
gatattaagcggatgcacgacgtgctgaaggacgagctgaactcggtgcagacgacgatc
gcggcgggacagcgggcgcacatactggcggagattgaaagtatcttggtgtacgcgctg
caggtcaacagtcagcggaatttgtgcgcgtcgacggttcggttcttggaggcgtggggc
caggtgacggaggtgttgtttagtgtgacgccggcgatgtttgtgtcgttggatgtgaag
aaggggttgttggtggagattgtgcaggcggtgctggggaaggtcgtgccgaaccagacg
atgccggagttggcgaatttggcgtcgtcgtcggtgctgctgttgatggtgaatttgagg
cattgctactcgctgaagaatagcgggcaggagggggtgcagggtgcatctctcgtggct
gggagcttcagcggacaggttgggggtatgttttcgccgaaaacgaacacgctgagcttg
aggtacattttgcaaaacatattggagtggatattgatcagtggggtggggtcgcagaag
ttgcggatcaatttgtacgcggcgctgctgaattacatgcacatcgtgaaggggaatcgc
gaccagagtgagaaggagcaagcggacgggggtggagtctcaccgagggatgagttctac
gtgtcgcggttggacaagagtttgggcaaggcgcttgacgggacgacgcacggaacgtcg
gacgagtcgcacgcccagatcgagatggtcatcgaaatcttccagtcgtttggggacaaa
ctgattgacattctgtgccacgactgcaccggaggacacgacatctgcaagatgttggcg
ctgtcctgtatcgatatgctgctggacatggactcgctggccagcgtaattcagttcatc
tcgaagcgcggctatttggcgcacctcatcgacagtttgctcaagagcgatggaaggttg
tgccggattctggacaaacagccggagaacatgaaggcgctgtacgtgtacgagtcgaaa
ctggccatgttgagtcgcatcggaggatcgcacatcggcgctgaactactcctcgaagag
aaggctctcagcgtgctggccggcatgaaggtcttcgacctccatccagacttccaagtg
gtcacctactcatcccacagtcaaccctcgtcatccttcattccgccgatcgacgctcgt
taccgccagatcctcttcccggccctcaacctctgcgacgtcatcctgtcaaccctcggc
caggagaaccactccgccgtcacccaaatcatccacttcctcctgtcccacggagacacc
atcgagatcgtcctccgcgccggcacccccttcctcgacctcggcctccttcaagaactc
gccggcatcaccagtctgatcgcccgcgccgccaaccaggaaatctacaacctcatcacc
ccgaacgccaaccaggatctccgcgcccacctccatcgactccagaagctcatgctgacg
ctcctcccccgattcaccctctccgagcagaccctcaaagagctcaaccaaaccatccta
acccactcaacggaacgcgaacggtccgcccacctgcgctacatcctgcagatcgccgcc
aacctggcgttgtacgcgcgcaacagcatctcgaaccacgccgtcgatcaccgcaccatc
agcgtgctcttttcgccgcagatcggcgagagccatcagggtcagggcgagaccgccagc
cacagcttgaacattgtcgtcgtccagctgaagcattccgtcgagtattacaaccgcgag
cggttgtcgctggagagtatgctgagacagcggaactcgctgcccagtttgagcttggac
acgaatgtccaaatccagcacaacaacctgacggagcgactgtccagcaagcaggaggag
ctgaaacgctgcgtcttcatcacggaacactgcctctacctgttgtgggcccatctggac
tttttcatgctgcgcgccatccccgtcagcacgctgcactttaacaacgtgtcgtacggc
gctgataactacctgtcggcccagacggaggtcggctggaagatcaccgccgaggacgtg
gccacgctgaaaaagtccttgattgcggtgtttaacgagacgttctgcaagcagctgctg
gcgacggcgcaggaccatgcgcgcgcctccgacaagggattcatcgaggcgttgctgcgg
cggatcaagcggctgattcagtttgtgcccgtgaagtag

DBGET integrated database retrieval system