KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003755Help
Entry
CpipJ_CPIJ003755  CDS       T01079                                 

Definition
nuclear pore complex protein Nup205
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CpipJ_CPIJ003755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1972 aa AA seqDB search
MSEATPDDMWTPFKHLFNSIESFLVTPAGGAGQQQEQNVASLDALLRKHKQNFSTLLRNP
PKNGKSREAIRQGITEGITLPEFGHTILSKDLVDESVILSDMYDLNELIVLELLCTAQQQ
MPNHPGLPRGLVAVLLYYDGRKSLVASLKELFQARAGVSWCTDAPQEITQLITAYTDGLV
ADGLLDKIVDLLGELDVTKELDVLTTNRALGPPKHHRQVLDLFEEIRVLLATCLFNWAAQ
CGLPKGTTVKLIRHLAKYKSTVSSGGIDNVTLALQMALMYALDMSVIQRREDGEDVVKRL
PMVRDGEFIETVMETLSASWECEGLRSVSLFTFGLAIATLRLAPQNMYSNTARIIDQDEL
LVDAAIQGRVFDFIHYTLLENEVLFRTEFYYRRMHVLFTDFIELMHSKVTELRARADETA
RTVQAFQQQGLDPPANLCRNFEALLLSVGKLYANDPMHLSLSLEYWGPMEVAANYQRASS
RSVCLFKFIRLAGELLPPILFIPYLKMLAGLSSSPQSARNAFNLLKQGSGGGIGGAAATI
SWDHFFNSLFRYYQNLRQEQNPGSETVYRSRALSRNINPQEIAGLQAVLLVIRAVATYDE
VARVALCEHPNWAPLHVLLGLISCSVPIALKAELVQTLAALGKSKETALQLWNNLEASQV
IATIPTTSTFVNRGIESELEEIESRNETYPLALGMLDLLYTLCETAIPKGIGAGPRKPGL
DPYVTFIIDAVFLRFYNRNYKNPAEKWQIAEKCLQLLHAFVRNYTPSPQDFPSPTAVREE
NSPPGFHILLQVNTKSDFLRLLLHIIDESCTLFDSYTPFPGRKHLEATSLYALQILERAL
ETQEDFFNAHFTSNCSILLAGANKLLLGLNPRSGKADHMLNVTRFVTYSSWLPENALVAI
RILAAIMRQPNVNQQILGLFTQNERITNEIRQGFVECLESERVSEFQQQDDELDEFSGGG
GGSSVELLIKEAIVALLADCLPQQATPNLAHYLLGFELNKELRLTNLQQPGVLNFPSNCA
KSLITLLDGALEQSKSGKALAPAHERLVENAYALLYTLCYNSRTSEVILRFLRSCNDFLC
RHIQGLPFANVASPHVLNQMTGLLKCVSQFGNLCKILLGVVQRDRDNQQQNQIDEMSQHH
QYSTTFNGSMLSASMVGGDAPKSASSAAESAKLLLCQLLDCLNFEIKSLEKPKWDYFDNA
VLVGLFQSCELAVAGGLKLVDIKRMHDVLKDELNSVQTTIAAGQRAHILAEIESILVYAL
QVNSQRNLCASTVRFLEAWGQVTEVLFSVTPAMFVSLDVKKGLLVEIVQAVLGKVVPNQT
MPELANLASSSVLLLMVNLRHCYSLKNSGQEGVQGASLVAGSFSGQVGGMFSPKTNTLSL
RYILQNILEWILISGVGSQKLRINLYAALLNYMHIVKGNRDQSEKEQADGGGVSPRDEFY
VSRLDKSLGKALDGTTHGTSDESHAQIEMVIEIFQSFGDKLIDILCHDCTGGHDICKMLA
LSCIDMLLDMDSLASVIQFISKRGYLAHLIDSLLKSDGRLCRILDKQPENMKALYVYESK
LAMLSRIGGSHIGAELLLEEKALSVLAGMKVFDLHPDFQVVTYSSHSQPSSSFIPPIDAR
YRQILFPALNLCDVILSTLGQENHSAVTQIIHFLLSHGDTIEIVLRAGTPFLDLGLLQEL
AGITSLIARAANQEIYNLITPNANQDLRAHLHRLQKLMLTLLPRFTLSEQTLKELNQTIL
THSTERERSAHLRYILQIAANLALYARNSISNHAVDHRTISVLFSPQIGESHQGQGETAS
HSLNIVVVQLKHSVEYYNRERLSLESMLRQRNSLPSLSLDTNVQIQHNNLTERLSSKQEE
LKRCVFITEHCLYLLWAHLDFFMLRAIPVSTLHFNNVSYGADNYLSAQTEVGWKITAEDV
ATLKKSLIAVFNETFCKQLLATAQDHARASDKGFIEALLRRIKRLIQFVPVK
NT seq 5919 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaagccactccggacgatatgtggacgccgttcaagcatctgttcaacagcatc
gagagcttcctggtgacacccgccggcggcgccggtcaacagcaggagcagaatgtggcc
agcttggacgcgctgctgcggaagcacaagcaaaactttagcactttgctgcggaatccg
cccaagaatggcaagagtcgggaggctattcggcaggggatcacggaggggattacgttg
ccggagtttggacatacgattctgtcgaaggacttggtggatgagagcgtgattttgtcg
gatatgtacgacttgaacgagttgatcgtgctggagttgttgtgtacggcgcagcagcag
atgccgaaccatccggggttgccgcgggggttggtggcggtgttgctgtactatgacggg
cgtaagtcgctggtggcgtcgttgaaggagctgtttcaggcgcgggcgggggtgagttgg
tgcacggacgcgccgcaggagattacgcagctgattacggcttacacggacgggttggtg
gcggatgggttgctggataagattgtggatttgctgggggagctggacgtgacgaaggag
ttggacgtgctgacgacgaatcgggcgttggggccgccgaagcatcaccggcaggtgttg
gatttgtttgaggagattcgggttttgttggcgacctgtttgttcaattgggcggctcag
tgtggactgccgaagggcacgacggtgaagttgattcgtcatttggccaagtacaagtcg
acggtgagttcgggggggattgacaatgtaacgctggcgctgcagatggcgttgatgtac
gcgctggacatgagcgtgattcagcggcgggaggatggtgaggacgtggtgaagcggttg
ccgatggttcgggatggggagtttattgagacggtcatggagacgctgtcggcgagctgg
gagtgcgaaggactgcggtcggtttcgttgtttacgttcgggttggcgattgcgacgctg
agattggctccgcagaatatgtactcgaacacggcccggatcatcgaccaggatgaactg
ctggtggacgcggctattcagggacgggtgtttgactttatccattacacgctgctggag
aacgaagtgttgtttaggacggagttttactaccgtcgcatgcacgtcctcttcacggat
ttcatcgagttgatgcactccaaggtgacggaacttcgtgcgagggcggatgagacggcg
agaaccgtgcaagccttccagcagcagggcctggatccacctgcgaacctctgtcggaac
tttgaagcgttgcttctgtccgtggggaagctctacgccaacgatccgatgcatctctcg
ttgtccctcgagtactggggaccgatggaagtggccgccaactatcagcgcgcatcgtcc
cgctccgtgtgcctgttcaagtttatccgactggcaggagagttgctgccaccgattctg
ttcattccgtatctgaagatgctcgccggcctgtccagctcgccgcaatccgctcggaat
gcgttcaatctgctgaagcagggaagcggaggtggcattggaggcgcggctgccaccatc
tcgtgggaccactttttcaactcgctgttccgttactaccagaatctacgccaggagcag
aaccccggttccgagacggtttaccgcagtcgagccttgagcaggaacatcaacccgcag
gagattgctggtttgcaagcggtcctgctggtgatccgtgccgtggccacctacgacgaa
gtggcgcgtgttgcgctctgcgagcacccgaactgggcgccactccacgtcctgctcggc
ctcatcagctgctccgtcccgatcgccctgaaagccgaactcgtccaaacgctggccgcc
ctcggcaaatccaaagaaaccgccctccaactgtggaacaacctggaggcgtcccaggtc
atcgcgaccatccccaccacaagcaccttcgtcaaccgcggcatcgagtccgagctggaa
gagatcgaaagccgcaacgaaacctacccgctggccctcggcatgctggacctgctctac
accctgtgcgaaacggccatcccgaagggcatcggcgccggtccccgcaaacccggcctc
gacccgtacgtcaccttcatcatcgacgccgtcttcctgcgcttctacaaccgcaactac
aaaaaccccgccgagaagtggcaaatcgcagaaaagtgtctccagctactgcacgccttc
gtccgcaactacaccccctccccgcaggacttcccctcgccaaccgccgtccgcgaagaa
aactccccgcccggcttccacatcctgctccaggtcaacaccaagtccgacttcctccgt
ctcctcctgcacatcatcgacgaatcctgcaccctgttcgacagctacacgcccttcccc
ggccggaagcacctggaagcgacctccctctacgccctccaaatcctcgaacgcgccctc
gaaacccaggaagacttcttcaacgcgcacttcacctccaactgctcgatcctgctggcc
ggcgccaacaagctgctgctcgggttgaacccccgctccggcaaggccgaccacatgctc
aacgtcacgcgcttcgtcacgtacagctcgtggctgccggagaacgcactcgtcgcgatc
cggatcctcgcggcgatcatgcgccagcccaacgtgaaccagcagatcttgggactattt
acgcagaacgagcgcatcacgaacgagatccggcaggggttcgtggagtgcttggagagc
gagcgggtcagcgagttccagcagcaggacgacgagctggacgagttttccggtggtggt
ggcggatcgagcgtggagttgttgatcaaggaggcgatcgtggcgttgctggcggattgc
ttgccgcagcaggcgacgccgaacttggcgcactacctgcttgggttcgagctgaacaaa
gaacttcgattgacgaacttacaacagccgggcgtcctcaacttccccagcaactgcgcc
aaatcgctgatcacgctgctggacggcgcgctcgagcagtccaaatccggcaaggcgctt
gcgcccgcccacgaacgcctcgtcgagaacgcgtacgcgttgctttacaccctgtgctac
aacagtcgcacttcggaggtcattctgcgcttcctgcgcagctgcaacgactttctgtgt
cgtcacatccagggtctgccgttcgcgaacgtcgcaagcccgcacgtgttgaaccagatg
acgggcctgctgaagtgcgtgtcgcagtttgggaacctgtgcaagatcctgctgggggtg
gtgcagcgcgatcgagacaatcagcagcagaatcagatcgacgagatgtcccagcaccat
cagtacagtacgactttcaacgggagcatgctgtcggcttcaatggtggggggagacgcg
cccaagtcggcgtcgtcggcggcggagtcggcgaagctactgctctgtcagctgctggac
tgtttgaactttgagatcaagtcgctggagaagcccaagtgggactactttgacaacgcg
gtactggtggggctgttccagagctgtgagttggcggtggcggggggtttgaagttggtg
gatattaagcggatgcacgacgtgctgaaggacgagctgaactcggtgcagacgacgatc
gcggcgggacagcgggcgcacatactggcggagattgaaagtatcttggtgtacgcgctg
caggtcaacagtcagcggaatttgtgcgcgtcgacggttcggttcttggaggcgtggggc
caggtgacggaggtgttgtttagtgtgacgccggcgatgtttgtgtcgttggatgtgaag
aaggggttgttggtggagattgtgcaggcggtgctggggaaggtcgtgccgaaccagacg
atgccggagttggcgaatttggcgtcgtcgtcggtgctgctgttgatggtgaatttgagg
cattgctactcgctgaagaatagcgggcaggagggggtgcagggtgcatctctcgtggct
gggagcttcagcggacaggttgggggtatgttttcgccgaaaacgaacacgctgagcttg
aggtacattttgcaaaacatattggagtggatattgatcagtggggtggggtcgcagaag
ttgcggatcaatttgtacgcggcgctgctgaattacatgcacatcgtgaaggggaatcgc
gaccagagtgagaaggagcaagcggacgggggtggagtctcaccgagggatgagttctac
gtgtcgcggttggacaagagtttgggcaaggcgcttgacgggacgacgcacggaacgtcg
gacgagtcgcacgcccagatcgagatggtcatcgaaatcttccagtcgtttggggacaaa
ctgattgacattctgtgccacgactgcaccggaggacacgacatctgcaagatgttggcg
ctgtcctgtatcgatatgctgctggacatggactcgctggccagcgtaattcagttcatc
tcgaagcgcggctatttggcgcacctcatcgacagtttgctcaagagcgatggaaggttg
tgccggattctggacaaacagccggagaacatgaaggcgctgtacgtgtacgagtcgaaa
ctggccatgttgagtcgcatcggaggatcgcacatcggcgctgaactactcctcgaagag
aaggctctcagcgtgctggccggcatgaaggtcttcgacctccatccagacttccaagtg
gtcacctactcatcccacagtcaaccctcgtcatccttcattccgccgatcgacgctcgt
taccgccagatcctcttcccggccctcaacctctgcgacgtcatcctgtcaaccctcggc
caggagaaccactccgccgtcacccaaatcatccacttcctcctgtcccacggagacacc
atcgagatcgtcctccgcgccggcacccccttcctcgacctcggcctccttcaagaactc
gccggcatcaccagtctgatcgcccgcgccgccaaccaggaaatctacaacctcatcacc
ccgaacgccaaccaggatctccgcgcccacctccatcgactccagaagctcatgctgacg
ctcctcccccgattcaccctctccgagcagaccctcaaagagctcaaccaaaccatccta
acccactcaacggaacgcgaacggtccgcccacctgcgctacatcctgcagatcgccgcc
aacctggcgttgtacgcgcgcaacagcatctcgaaccacgccgtcgatcaccgcaccatc
agcgtgctcttttcgccgcagatcggcgagagccatcagggtcagggcgagaccgccagc
cacagcttgaacattgtcgtcgtccagctgaagcattccgtcgagtattacaaccgcgag
cggttgtcgctggagagtatgctgagacagcggaactcgctgcccagtttgagcttggac
acgaatgtccaaatccagcacaacaacctgacggagcgactgtccagcaagcaggaggag
ctgaaacgctgcgtcttcatcacggaacactgcctctacctgttgtgggcccatctggac
tttttcatgctgcgcgccatccccgtcagcacgctgcactttaacaacgtgtcgtacggc
gctgataactacctgtcggcccagacggaggtcggctggaagatcaccgccgaggacgtg
gccacgctgaaaaagtccttgattgcggtgtttaacgagacgttctgcaagcagctgctg
gcgacggcgcaggaccatgcgcgcgcctccgacaagggattcatcgaggcgttgctgcgg
cggatcaagcggctgattcagtttgtgcccgtgaagtag

DBGET integrated database retrieval system