KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ003940Help
Entry
CpipJ_CPIJ003940  CDS       T01079                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L5
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 323 aa AA seqDB search
MADSAGEWCLIESDPGVFTELIREFGVEGVQVEELWSLDEERFKELDPVHGLIFLFKWVK
DEPAGSIVQDSRLEKIFFAKQVINNACATQAILSILLNSKHSDIKLGSTLTDFKEFCMSF
DAQNKGLALSNASQIRTVHNSFARQTLFELDNKQANKDDDVFHFVGYIPIDGRLYELDGL
KEGPIDLGAVGPEEDWISVVRPIIEKRIQKYSEGEIHFNLMALVTDRQLIYQRQIDQLLQ
QADDAMDTDTKQEEITRLRLHIEDEVAKRKRYKVENIRRKHNYLPLIVELLKVLAANGQL
MPLYEKAKQRAIEREATKVAAQK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggccgacagtgctggagaatggtgcctgatcgagtccgatccgggcgtgttcaccgag
ttgatccgggagtttggtgttgaaggggtccaggtggaggagctgtggagtctggacgag
gaacgctttaaggagttggatccggttcacgggttgattttcctgtttaaatgggtaaag
gatgagccggcgggatcgattgtgcaggatagccgactggagaagatcttctttgccaag
caggttattaataatgcgtgcgctacccaggctattctgagcattttgttgaacagcaaa
cattccgacataaagctcggttcgacgctgaccgactttaaggagttttgcatgtccttc
gacgcacagaacaaagggctggctttgtcgaacgcgtcccagatccggactgtgcataat
tccttcgcgaggcagacactcttcgagctggataacaagcaggccaacaaggatgatgat
gtgttccactttgtcggttacattccgatcgatggccgtctttacgagctcgatggcctc
aaggaaggtccgatcgatttgggcgcagtcggtcccgaggaggactggatcagcgtagtg
cggccaataatcgagaaacggatccaaaagtacagcgaaggagagattcactttaatctg
atggctttggtcacggatcggcagttgatttaccagcgccagattgatcagctgctgcag
caggccgatgacgcgatggacacggatacaaagcaggaggaaatcacccggcttcggctg
cacatcgaggacgaggtggccaaacgaaagcgctacaaggtggagaacattcgccgcaaa
cataactatttgccactgatagttgaactgctgaaggtcctggcggccaacggccagctt
atgccgctgtacgaaaaagctaaacagagggctatcgaacgagaggcgaccaaggtggcc
gcgcagaagtag

DBGET integrated database retrieval system