KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004049Help
Entry
CpipJ_CPIJ004049  CDS       T01079                                 

Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CpipJ_CPIJ004049
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CpipJ_CPIJ004049
  Amino acid metabolism
   00310 Lysine degradation
    CpipJ_CPIJ004049
Enzymes [BR:cqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CpipJ_CPIJ004049
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 482 aa AA seqDB search
MAGLLSISSRNLPRTALRISLRSLEGSNQQVSQASRSYHQGRAVLQRLVRAAATEAAPSS
QQSTIVASRWMLSERNIFTSARLLSSEIVKVPPFADSVSEGDVKFEKKVGDAVAADEVVM
EIETDKTTVGVPSPAHGIIEEIFVADGDTVKSGQQLFKLKVTGEAPKAAAKPAEAAAPAA
AAPPPPPPPPVAAARPPPPAAAAAAPPPPPPRPAAPISKMPVAAIRHAQAIEAATVKVPP
ADYSKEITGTRSEQHVKMTRMRLKIASRLKEAQNTNAMLTTFNEIDMSFIMDFRKQHLDA
FVKKYGIKFGFMSAFCKATAYALQDQPVVNAVIEENEIVYRDYVDISVAVASPKGLVVPV
LRNVEGMNYADIELSIAALADKAKKGTLAVEDMDGGTFTISNGGVFGSLLGTPIINPPQS
AILGMHGIFERPIAVKGQVVVRPMMYVALTYDHRLIDGREAVTFLRKVKAAVEDPRIILA
GL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggccggattgctatcaatttcgtcgcgtaacctcccgcgaaccgcgcttcgaatcagc
cttcgatcgctggagggaagcaaccagcaggtcagccaagcttcccgttcctaccaccag
gggcgtgccgttctgcagagattggttcgggcagccgccaccgaggcagcaccatcgtcg
caacaatctaccatcgtcgcctcgagatggatgctctcggagcgaaacatcttcacctcg
gccaggctgctgagttccgagatcgtgaaggtgccaccgtttgccgactctgtgtcggag
ggtgacgtaaagtttgagaagaaggtgggcgatgccgtggccgccgacgaggtcgtgatg
gagatcgagacggacaagaccacggtgggcgttccgtcgcccgcgcacggtatcatcgag
gagatcttcgtcgcggacggtgacaccgtaaagtccggccagcagctgttcaagttgaag
gtcaccggtgaagcccccaaggctgctgccaaacccgctgaggcggctgcaccggctgcg
gctgctcctccgccgccaccacccccgccagtggctgccgctaggccacctccaccagcg
gccgctgctgctgcccctccgccaccaccaccgcggccagcggctccgattagcaaaatg
cccgtcgcggccatccgtcacgcacaggccatcgaagcggccacggtgaaggtgccccca
gcggactacagcaaagaaatcaccggaacgcgctctgagcagcacgtcaagatgacccgc
atgcggttgaagattgcgtcgcgcctgaaggaagcccagaacacgaacgccatgctgacg
acgttcaacgagatcgatatgagcttcatcatggacttccgcaagcagcacctggacgcc
ttcgtcaagaagtacggtatcaagtttggcttcatgtctgccttctgcaaagccaccgcc
tacgccctgcaggatcaacccgttgtgaatgccgtcatcgaggagaatgaaattgtctac
cgcgactacgtggacatctcggtcgctgtggcgtcgcccaagggcctggtcgtgccagtg
ctgcgaaacgtcgagggcatgaactacgccgacattgagctgtcgattgctgccctcgcc
gacaaagccaagaagggtacgctggcggtcgaggacatggacggcggcaccttcaccatc
tcgaacggtggagtgtttggatcgctgctgggaacgcccatcatcaacccgccgcagagt
gccatcctcggcatgcacggaatctttgagcgtcctatcgcggtgaaaggacaggtcgtc
gtccgaccgatgatgtacgtcgcgctgacctacgaccaccgactgattgacggtcgcgag
gccgtcaccttcctgcgcaaggtcaaggccgccgtcgaggatccccgcatcatcctggct
ggactgtaa

DBGET integrated database retrieval system