KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004049Help
Entry
CpipJ_CPIJ004049  CDS       T01079                                 

Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CpipJ_CPIJ004049
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CpipJ_CPIJ004049
  Amino acid metabolism
   00310 Lysine degradation
    CpipJ_CPIJ004049
Enzymes [BR:cqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CpipJ_CPIJ004049
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 482 aa AA seqDB search
MAGLLSISSRNLPRTALRISLRSLEGSNQQVSQASRSYHQGRAVLQRLVRAAATEAAPSS
QQSTIVASRWMLSERNIFTSARLLSSEIVKVPPFADSVSEGDVKFEKKVGDAVAADEVVM
EIETDKTTVGVPSPAHGIIEEIFVADGDTVKSGQQLFKLKVTGEAPKAAAKPAEAAAPAA
AAPPPPPPPPVAAARPPPPAAAAAAPPPPPPRPAAPISKMPVAAIRHAQAIEAATVKVPP
ADYSKEITGTRSEQHVKMTRMRLKIASRLKEAQNTNAMLTTFNEIDMSFIMDFRKQHLDA
FVKKYGIKFGFMSAFCKATAYALQDQPVVNAVIEENEIVYRDYVDISVAVASPKGLVVPV
LRNVEGMNYADIELSIAALADKAKKGTLAVEDMDGGTFTISNGGVFGSLLGTPIINPPQS
AILGMHGIFERPIAVKGQVVVRPMMYVALTYDHRLIDGREAVTFLRKVKAAVEDPRIILA
GL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggccggattgctatcaatttcgtcgcgtaacctcccgcgaaccgcgcttcgaatcagc
cttcgatcgctggagggaagcaaccagcaggtcagccaagcttcccgttcctaccaccag
gggcgtgccgttctgcagagattggttcgggcagccgccaccgaggcagcaccatcgtcg
caacaatctaccatcgtcgcctcgagatggatgctctcggagcgaaacatcttcacctcg
gccaggctgctgagttccgagatcgtgaaggtgccaccgtttgccgactctgtgtcggag
ggtgacgtaaagtttgagaagaaggtgggcgatgccgtggccgccgacgaggtcgtgatg
gagatcgagacggacaagaccacggtgggcgttccgtcgcccgcgcacggtatcatcgag
gagatcttcgtcgcggacggtgacaccgtaaagtccggccagcagctgttcaagttgaag
gtcaccggtgaagcccccaaggctgctgccaaacccgctgaggcggctgcaccggctgcg
gctgctcctccgccgccaccacccccgccagtggctgccgctaggccacctccaccagcg
gccgctgctgctgcccctccgccaccaccaccgcggccagcggctccgattagcaaaatg
cccgtcgcggccatccgtcacgcacaggccatcgaagcggccacggtgaaggtgccccca
gcggactacagcaaagaaatcaccggaacgcgctctgagcagcacgtcaagatgacccgc
atgcggttgaagattgcgtcgcgcctgaaggaagcccagaacacgaacgccatgctgacg
acgttcaacgagatcgatatgagcttcatcatggacttccgcaagcagcacctggacgcc
ttcgtcaagaagtacggtatcaagtttggcttcatgtctgccttctgcaaagccaccgcc
tacgccctgcaggatcaacccgttgtgaatgccgtcatcgaggagaatgaaattgtctac
cgcgactacgtggacatctcggtcgctgtggcgtcgcccaagggcctggtcgtgccagtg
ctgcgaaacgtcgagggcatgaactacgccgacattgagctgtcgattgctgccctcgcc
gacaaagccaagaagggtacgctggcggtcgaggacatggacggcggcaccttcaccatc
tcgaacggtggagtgtttggatcgctgctgggaacgcccatcatcaacccgccgcagagt
gccatcctcggcatgcacggaatctttgagcgtcctatcgcggtgaaaggacaggtcgtc
gtccgaccgatgatgtacgtcgcgctgacctacgaccaccgactgattgacggtcgcgag
gccgtcaccttcctgcgcaaggtcaaggccgccgtcgaggatccccgcatcatcctggct
ggactgtaa

DBGET integrated database retrieval system