KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004076Help
Entry
CpipJ_CPIJ004076  CDS       T01079                                 

Definition
bifunctional protein NCOAT
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CpipJ_CPIJ004076
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     CpipJ_CPIJ004076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1070 aa AA seqDB search
MAEPSKEQQQQQQLSPVLGSGESKPRCDGSEREAGFLCGVVEGFYGRPWTTEQRKDLFRK
MKQWGMDSYIYAPKDDYKHRAYWRELYTVEEADHLTGLISAAHEQNINFYYALSPGLDIT
YSSSKELATLKRKLDQVSQFGCKAFALLFDDIEPEMSKPDKEVFQSFAYAQVSVTNEIYN
HLNCPRFLFCPTQYCSSRAVPTVKQSEYLNTLGSKLIGNIDILWTGEKVISKLLTVECIQ
EITEVLKRPPVIWDNLHANDYDQKRVFLGPYSGRSPEIIPLLRGVVTNPNCEFHANSIAI
QTLAFWSKCSSDTKISSSVSSDIKLETENEDGICQEDAPAFLSQNVYHPRLALKNAIANW
LPEFYQEKEAWGPISKPQPAVTMVMPIIPIIPSVNTCMTLTSTSTTTTTTANPMPVPEVN
TTQLQLFADVCSTVTSAPESVPAPIMNSLVSATKVVTNESLPNPVTAAVTNLAIPTTIPI
SSIPGPIMSIKTTDASIDDCSGEDKGNMSEPLEDDAVIENDLEQQQLDDEENMTVNDEVV
INQVKINIEEDDGGVKAVEPMECGSSLTSPKHVMKTHFDDVMMSETTSVRVKGIVRTCSG
SMQVESSDTSLVSNAEMAEFKNAHEKELTCADIMLLCDLFYLPFEHGSKALQLLAEFHWL
KINAQVLCKNRSRKPSLATTPTAGDSKSAASDGHHLNNGTTSGESSTTTKDGCNKSEVQE
WIRRSETFENLCQTIFRVTRKIARCPNKELCYDLFSYVWDIAAVLSMLSAYVKWLAMGNF
PANINSYTQGGYTWFSKGWKETFTSGDQEPWVFRGGLVADLQRLIPLDVGNDLFLYKLPE
TSAVNLYTMRPYVYTDETILLDVCNRTANDGEPFNLGSDTLKSVLADRYLGPFLTIAPQL
CIVAENNSSEIVGYACAATDTKTFLRNMEQCWVPEMCLKYPLSIVENGAPSQEPASSPTG
TTAQANQLARDCILYFHNFKNDYPAAVLNTHPSILSTRILKPHLLEDEALGKRLVTVLLA
MLRSNGSSSGVHVCIEQTDQFMYQFYSKLGFVELYREDGGDSVVYLGRNF
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaccatcgaaggaacagcagcagcagcagcaattgtctccggtgctcggttcc
ggcgagagtaaaccgcgctgcgacgggtcggaacgggaggccggattcctgtgcggcgtg
gtggaaggattttacgggcggccgtggacgacggaacagcgcaaggatctgttccggaag
atgaagcaatggggcatggactcgtacatttacgccccgaaggatgactacaaacaccga
gcttactggcgggagctgtacaccgtcgaggaggcggaccatttgacggggctgattagt
gcggcccacgagcagaatattaatttttattacgcgctttcgccggggttggacatcacg
tacagtagcagtaaggagctggccactttgaagcgaaagttggaccaggtgtcacagttt
gggtgcaaagcgttcgcgttgctgtttgatgacattgagccggaaatgagcaaaccggac
aaggaagtgttccagagctttgcgtacgcgcaggtgtcggtgacgaacgagatttataac
catttgaattgtccccggtttctgttctgtccgacgcagtactgcagttcaagagcggtt
cccacggtgaagcagtcggaatatctcaacacgctgggaagtaagcttatcggcaacatt
gacattctgtggaccggcgagaaggtcatttccaagctgcttacggtcgagtgcattcag
gagattacggaagtgctcaaacgaccgcccgtcatttgggacaatctgcacgcgaacgat
tacgaccagaagcgtgtcttcttgggcccgtactcgggccgctcgccggagattattccg
ctgctgcgcggagtggtcaccaacccgaactgtgagtttcacgccaattccatcgccatt
cagacgcttgccttctggagcaagtgcagctcagacacgaagatcagttcgtccgtgtcg
tcggatattaagctggaaacggaaaacgaggacggaatttgccaggaggatgcgccagcc
tttttgtcgcagaatgtgtaccatccacggctggcgcttaaaaatgccatcgcaaactgg
ttgccggagttttatcaagaaaaggaagcgtggggaccgatcagcaaaccgcaaccggct
gtaactatggtcatgcccatcattccaatcattccatcggtcaacacgtgcatgacgctg
acgagcaccagcacgacgacgacgaccaccgcgaacccgatgcccgtgcccgaggtcaac
acgacgcagctgcagcttttcgcggacgtttgcagcaccgtaacgagcgccccggaaagc
gtgcccgcgccgatcatgaactcgctcgtgtccgccaccaaggtggtcaccaacgaatca
ctgccaaatccggtgaccgccgccgtgacgaaccttgccatcccgacgaccatccccatc
tcgagcattcccggtccgatcatgagcattaagacgacggatgcgtcaatcgacgactgc
agcggcgaggacaaaggcaacatgagcgaaccgttggaggacgacgccgtgattgagaac
gacctggagcagcagcagctcgacgacgaagagaacatgaccgtcaacgatgaggtggtg
atcaatcaggttaaaatcaacattgaggaggacgacggcggcgtgaaggcggtagaaccg
atggagtgcggaagtagtctgacgtcgccgaagcacgtgatgaagacccactttgacgac
gtgatgatgtcggagacgacatcggtaagggttaagggcattgtgagaacctgttccgga
agcatgcaggttgagagttcggacacgtcgttggtatcgaacgcagagatggcagaattc
aagaacgcccacgaaaaggaactgacgtgcgccgacatcatgctgctgtgcgatttgttc
tatctaccgttcgagcacggcagcaaggcgctccagctgttggccgagttccactggctc
aagataaacgcccaggtgctgtgcaaaaaccggtcacgcaagccaagcctggcgacaact
ccgactgcgggggattcgaagagtgcagccagtgacggtcaccacttgaacaacggaacg
acgtccggtgaatctagcaccaccaccaaggatggctgcaacaagagcgaggtgcaggaa
tggattcgccggtccgagacgttcgagaatctttgccagacgattttccgagtgacgcgc
aagattgcccgctgtccgaacaaggagctgtgctacgatctgttttcgtacgtgtgggac
attgcggccgtgctgtcgatgctgagcgcctacgtcaagtggctcgcaatggggaacttt
ccggccaacattaattcttacacccagggcggttacacctggttcagcaaaggttggaag
gaaaccttcacttccggtgatcaggagccgtgggtgtttcggggtggtttggtggcagac
ctgcagcgacttatcccgctggacgtcggaaacgatttgttcctgtacaaactgccggaa
acgtccgcggtcaacctttacacgatgcgaccctacgtttacaccgacgagacgatcctg
ctggacgtttgcaaccggacggcgaatgacggtgaaccgttcaacctcggttcggacact
ttgaagagcgtactagccgatcgatacctgggaccgttcctgacaatcgccccgcagctc
tgcatcgtggcggagaacaacagttccgaaatcgtcgggtacgcgtgtgccgcaacagac
accaagaccttcctgcgcaacatggaacagtgctgggtcccggaaatgtgtctcaagtat
ccactgtccatagtggaaaacggagccccatcacaagaaccagccagctcaccaaccggc
accaccgcccaagcgaaccagctcgctcgtgattgtattctgtatttccataactttaag
aacgattatcctgccgcggtccttaacacccacccgtcgattctgtccacccgcatcctc
aaaccccatctgctggaagacgaagcgctaggcaaacgtctcgttactgtcctgctggca
atgctacgctcaaacggatcttccagcggtgttcacgtgtgcatcgagcaaaccgaccag
ttcatgtatcaattctacagcaagctgggcttcgtcgagctgtaccgggaggacggcggc
gactctgtggtctacttgggccggaacttttga

DBGET integrated database retrieval system