KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004187Help
Entry
CpipJ_CPIJ004187  CDS       T01079                                 

Definition
elongator component
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CpipJ_CPIJ004187
Transfer RNA biogenesis [BR:cqu03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CpipJ_CPIJ004187
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 446 aa AA seqDB search
MDQLWFPWNELSISAIPASASFTKAGFEDHNGVKILAVSCVLEVGRVAQLPSLDTASFTK
AGLENHDGVKILAVSCVLEDYRDYFIRNLHDALSGHTSSSVEEAVRYSEKSHTKCIGITI
ETRPDYCLNRHLSDLLAYGCTRLEIGVQSVYEDVARDTNRGHTVKATCESFQMSKDAGFK
VVSHMMPDLPNVDIERDVEQFIEFFENPDFRADGLKIYPTLVIRGTGLYELWKTGRYKSY
PPSTLVDLVAKILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGADCRD
VRTREVGIQEIHNKVRPYEIELIRRDYVANGGWETFLSYEDPKQDILVGLLRLRKCSPAT
FRPELVDNCSIVRELHVYGSVVPVNARDPTKFQHQGFGMLLMEEAERIAREEHGSRKLAV
ISGVGTRNYYRKMGYELDGPYMSKEL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggatcaactatggttcccttggaacgagctgtcaatttctgccatcccagcgtccgcg
tcattcacgaaggccggatttgaggaccacaacggagtaaagattctcgcggtctcttgc
gtcctcgaagtcggccgggtcgcgcaactgccatcgctggacaccgcgtcattcacgaag
gccggattagagaaccacgacggagtcaagattctcgcggtctcttgcgtgctcgaggat
tatcgggactattttattcggaatttgcacgacgcgttgtcgggacacacgagctcgagc
gtggaggaggcggttcggtattcggaaaagtcgcacaccaagtgcatcgggataacgatt
gagacgcggccggattattgtttgaatcgccacttgtcggatttgttggcttacggatgt
acacggctggagattggcgttcagtcggtttacgaggacgtggcgcgggacacgaaccgg
ggccacacggtgaaggcgacgtgtgagagcttccagatgagcaaggacgccgggtttaag
gtggtgtcgcacatgatgccggacttgccgaatgtggacattgagcgagatgttgagcag
tttatcgagttcttcgagaatccggactttcgcgccgacgggttgaagatctatccgacg
ttggtaattcgtggaactgggctgtacgagctgtggaaaaccggacggtacaagagctac
cccccgtcgacgttggtggatttggtggcgaagatcttggcgttggttccgccgtggaca
cgcgtctatcgcgtccagcgtgacatcccgatgccgttggtcagttccggcgtggaacac
ggcaacctgcgcgagctggccctcgcccggatgaaggaccttggcgcggattgtcgtgac
gtgcgaacccgcgaggtcggcatccaggagatccacaacaaggtccgcccgtacgaaatc
gagctaattcggcgggattacgtggcgaacggcggctgggagacgttcctctcgtacgaa
gatcccaagcaggacattttggtggggctgttgcgactgcgcaagtgctcgccggccacg
ttccgacccgagctggtggacaactgttcgatcgtgcgagagttgcacgtgtacggatcg
gttgtgccggtgaacgcgcgcgatccgaccaagttccagcaccagggctttgggatgctg
ctgatggaggaggcggagcggattgcgagggaggagcatggaagcaggaagctggcggtc
atttccggcgttggcacgaggaattattatcggaagatggggtacgagctggatgggccg
tacatgtcgaaggagttgtag

DBGET integrated database retrieval system