KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004201Help
Entry
CpipJ_CPIJ004201  CDS       T01079                                 

Definition
mevalonate kinase
Orthology
K00869  
mevalonate kinase [EC:2.7.1.36]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Peroxisome
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CpipJ_CPIJ004201
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    CpipJ_CPIJ004201
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.36  mevalonate kinase
     CpipJ_CPIJ004201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 389 aa AA seqDB search
MSVAGFEVSAPGKVILHGEHSVVYGKPAIAGPIGLRTYLTYKRLQSPEVILDFASIPFNS
SLSLESFNAFLAQFDCHSNLQPLEFLEKMRSADGFPFASFVTRQPAQDSIKEKFSFGTAL
YLLNRILRSEGVESLESGFQLTLKSVMSIGAGLGSSAGYGVCVSAGAFLLSKIIKGELEA
KFALQDSPEVLEKISKWAFDSEIVMHERPSGIDNTICTYGNLIKFKRGEPFESLKLRQQV
NILIVDTGVSRTTAKLVAGVADLKSRHPGMMDAILDAMGHLVDDVVSILEDDGDRFEALR
TLVSINGNLLRAIGVSHPSLERIFRLAEESGFSAKLTGAGGGGCALVFLPQDYESSKEYA
ELTQNLTKAGFHWIQTTIGGQGVQFKALE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtagctggctttgaagtgtccgcccccggtaaggttatcctgcacggggagcat
tcggtcgtgtacgggaaaccggccattgccgggcccattgggctgagaacctatctcact
tataagcgcctccaatcccccgaagtcattctggactttgcctcaatcccgttcaactca
tcgctctcgctcgaatcgttcaacgccttcctcgcccagttcgactgccactcgaacctg
caaccgctcgaattcctcgaaaaaatgcgctccgccgacggctttccgttcgccagcttc
gtcacccgacaacccgcgcaagactcgatcaaagaaaagttctcctttggcaccgctctc
tacctgctgaaccgaatccttcgcagcgaaggcgtcgaatctctcgaaagtggcttccag
ctgacgctcaagtccgtgatgagcatcggtgccggcctgggcagttccgccggatacggc
gtttgcgtttccgctggtgcgtttctactctcgaagatcattaaaggtgaactcgaggcg
aagttcgcgctccaagactcacccgaagtgctggagaagatctccaagtgggcgttcgat
tcggagattgtgatgcacgagcggccttccggcatcgacaacacgatatgcacgtacgga
aatctcatcaagttcaagcgcggcgagccgttcgagagtctgaagcttcgccagcaggtc
aacatcctgatcgtggacaccggagtcagtcggaccacggcaaagttggtggcgggcgtg
gcagatttgaagagtcgccaccctgggatgatggacgcgattttggacgcgatgggacat
ctcgttgacgatgtggtttcgattctggaggacgacggcgatcggtttgaggcacttcga
acgctagtctcgatcaacggcaatctgctgcgggcgatcggcgtgagtcatccgtcgttg
gagcggatcttccggttggctgaagaaagtggatttagcgcaaagctgaccggagcgggt
ggtggaggctgtgcgttggtcttcttgccgcaggactacgaatcgagcaaggagtacgcg
gagttgacgcagaacttgaccaaggctggttttcactggattcagaccaccatcggagga
caaggagtgcagtttaaggcgctggaatga

DBGET integrated database retrieval system