KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004201Help
Entry
CpipJ_CPIJ004201  CDS       T01079                                 

Definition
mevalonate kinase
Orthology
K00869  
mevalonate kinase [EC:2.7.1.36]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Peroxisome
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cqu00900]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:cqu04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 389 aa AA seqDB search
MSVAGFEVSAPGKVILHGEHSVVYGKPAIAGPIGLRTYLTYKRLQSPEVILDFASIPFNS
SLSLESFNAFLAQFDCHSNLQPLEFLEKMRSADGFPFASFVTRQPAQDSIKEKFSFGTAL
YLLNRILRSEGVESLESGFQLTLKSVMSIGAGLGSSAGYGVCVSAGAFLLSKIIKGELEA
KFALQDSPEVLEKISKWAFDSEIVMHERPSGIDNTICTYGNLIKFKRGEPFESLKLRQQV
NILIVDTGVSRTTAKLVAGVADLKSRHPGMMDAILDAMGHLVDDVVSILEDDGDRFEALR
TLVSINGNLLRAIGVSHPSLERIFRLAEESGFSAKLTGAGGGGCALVFLPQDYESSKEYA
ELTQNLTKAGFHWIQTTIGGQGVQFKALE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtagctggctttgaagtgtccgcccccggtaaggttatcctgcacggggagcat
tcggtcgtgtacgggaaaccggccattgccgggcccattgggctgagaacctatctcact
tataagcgcctccaatcccccgaagtcattctggactttgcctcaatcccgttcaactca
tcgctctcgctcgaatcgttcaacgccttcctcgcccagttcgactgccactcgaacctg
caaccgctcgaattcctcgaaaaaatgcgctccgccgacggctttccgttcgccagcttc
gtcacccgacaacccgcgcaagactcgatcaaagaaaagttctcctttggcaccgctctc
tacctgctgaaccgaatccttcgcagcgaaggcgtcgaatctctcgaaagtggcttccag
ctgacgctcaagtccgtgatgagcatcggtgccggcctgggcagttccgccggatacggc
gtttgcgtttccgctggtgcgtttctactctcgaagatcattaaaggtgaactcgaggcg
aagttcgcgctccaagactcacccgaagtgctggagaagatctccaagtgggcgttcgat
tcggagattgtgatgcacgagcggccttccggcatcgacaacacgatatgcacgtacgga
aatctcatcaagttcaagcgcggcgagccgttcgagagtctgaagcttcgccagcaggtc
aacatcctgatcgtggacaccggagtcagtcggaccacggcaaagttggtggcgggcgtg
gcagatttgaagagtcgccaccctgggatgatggacgcgattttggacgcgatgggacat
ctcgttgacgatgtggtttcgattctggaggacgacggcgatcggtttgaggcacttcga
acgctagtctcgatcaacggcaatctgctgcgggcgatcggcgtgagtcatccgtcgttg
gagcggatcttccggttggctgaagaaagtggatttagcgcaaagctgaccggagcgggt
ggtggaggctgtgcgttggtcttcttgccgcaggactacgaatcgagcaaggagtacgcg
gagttgacgcagaacttgaccaaggctggttttcactggattcagaccaccatcggagga
caaggagtgcagtttaaggcgctggaatga

DBGET integrated database retrieval system