KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004679Help
Entry
CpipJ_CPIJ004679  CDS       T01079                                 

Definition
bile acid beta-glucosidase
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cqu00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cqu00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 913 aa AA seqDB search
MDGDSAQSFCEFKQQVSAVPQYGLKLKFNHVYPETRNQNLKPSFRQIWPIIPMALRYIPY
YWKVSREGRQVLMDYWYTENGKQIYGAPIGGIGAGTIGRGFAGEFCRFQMRPGLYEYNTV
HANQFIVTIKDENNVTIFQSLLSSYRTKDDEVHDVCAPNQTTLLHGLMPCETRPKTPLAS
WDSTINSSKCSYTALYPRAWSEYDLSEHGIKLVQRQISPIIPHDYKESSLPVAVFAWTVE
NVCGKDRHVTITFTFKNGTGNKKQDAEGNAETAAFAHGTAKGVSIKQTIADLPCTYCVSC
KTSSEINLTRCEKFDPSGNGEKLWNDLKENGHLTEKSGDESLKTKDVAVAVSAQILVPSE
SSSELEFSLVWDMPKIHFTKKMKEYYKYYTKYFGKNGDAGPVISDYALRNYGKWESLIDE
WQRPILDDSDLPDWYKSAIFNELYFIADGGSIWLAVDDTTLPYDDPRLAYGRYAYLEGHE
YRMYNTYDVHFYASHALASLWPNLQVSLQYDYKDAVQREITEGRKHLYDGKVIPRKIKSS
VPHDLGDPDEEPFELINAYPIHDVSEWKDLNTKFILQVYRDYYTLNHYAQLNADNASKFS
SIEFIDKESMFEMYVQDNRNKVSPEDKAQNRKSASMYINETNGKVYLMDAMTYLKSMYPA
CKQVLEKTLEWDKDNDGLIENSKSPDQTYDTWVMDGPSSYCGGLWLASLHCMSVMANLLD
QSEDCIKYREILEKGKASFEEKLWNGSYYKFDSQSSSKNSIMSDQLCGHWYLRCCGFDYD
IVPKENVRTALKTIYDNNVMRFCGGNMGAVNGYIPSSQPNKDGRADSSTLQAEEVWTGVT
YALASTMIHEGMFTEAFQTAGGLYQTLSEKIGMSFETPEALYAERHYRAIGYMRPLSIWS
MQTAWEQKKQNRD
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggatggcgatagtgctcaatcgttctgcgagttcaaacaacaagtgtccgcggtgccc
cagtacggcctgaagctcaagttcaaccatgtctacccggaaacgaggaaccagaacctg
aagccgtcgttccggcagatctggcccatcatcccgatggcactaaggtacatcccgtac
tactggaaggtgtcacgcgagggccgccaggtgctgatggactactggtacacggaaaac
gggaagcagatttacggggccccgatcggcggcatcggcgccggcaccatcgggcgggga
ttcgccggcgagttttgccgcttccagatgcggccgggcctgtacgagtacaacacggtg
cacgcgaaccagttcatcgtcaccatcaaagacgagaacaatgtgaccattttccagagt
ctgctttcttcgtacaggactaaggatgacgaagtacacgatgtctgcgcgccaaaccaa
accacccttttgcatggcttgatgccgtgtgagacccgccccaaaacgccgctggccagt
tgggatagcaccatcaactcgtccaagtgcagctacacggcgctatatccgcgggcctgg
tccgagtacgacctaagcgagcacggcatcaagctggttcagcggcagatctcgccgatc
ataccccatgactacaaggagagctcgctgccggtggccgtcttcgcgtggaccgtcgag
aacgtgtgcggcaaggaccggcacgtgacgattacgttcacgttcaagaacggaaccggc
aacaagaagcaggacgccgagggaaacgcggaaacggcggcgtttgcccacgggacggcc
aagggagtcagcattaagcagacgatcgcggacttgccgtgcacttactgtgttagctgc
aagacttcgtcggagatcaacctgacgcggtgcgagaagtttgatccgagcggaaacggg
gagaagctgtggaatgatttgaaggagaatggccacctgacggagaagtccggcgacgag
agtttgaagactaaggacgtcgccgtagcggtcagcgcacaaattctggttccatccgag
tccagctcggagctggagttctcgctggtgtgggacatgccaaagattcactttaccaaa
aagatgaaagagtactacaagtactacaccaaatatttcggcaagaacggcgatgccggt
cctgtgatctcggactatgcgctgcgcaactacggcaagtgggagtccctgatagacgag
tggcagcggcccattctggacgatagtgaccttcccgactggtacaagagtgccatcttc
aacgagctgtactttatcgcggacggtggcagcatctggctggccgtggacgacaccacc
cttccgtacgatgatcccagattggcctacggtcgctacgcgtacctcgaggggcacgag
tatcggatgtacaacacgtacgacgttcatttctatgcgtcgcacgcgctggccagcctg
tggccgaatctacaagtcagcttacagtacgactacaaggatgctgtacagcgagagata
accgagggacggaagcatctctacgacgggaaggtcattccgcggaagataaaaagttcc
gtaccgcacgacctgggcgatcccgacgaggaaccgttcgagctgatcaacgcgtacccg
atccacgacgtgtccgaatggaaggatctgaacaccaagttcatcctgcaagtgtaccgc
gactactacacgctcaaccactacgcccagctgaacgcggacaacgcgagcaaattcagc
tcgattgagttcatcgacaaggagagcatgttcgagatgtacgtgcaggacaaccgcaac
aaagtttcgccggaggataaggcccagaaccggaagtcggcgtcgatgtacattaacgag
acgaatgggaaggtctatctgatggacgcgatgacctacttgaagagcatgtatccggcc
tgcaagcaggtgctggagaagaccctcgagtgggataaggataacgatgggctgatcgag
aacagcaagtcgccggaccaaacgtacgacacgtgggtcatggatggtccgagttcgtac
tgtggtgggttgtggttggccagtctgcactgcatgtcggttatggcgaacttgctggat
caatccgaggattgcattaaatatcgggagattttggaaaagggcaaagcctcgttcgag
gagaagctatggaacgggtcgtactacaagtttgacagccagagttcttcaaagaactca
atcatgtccgaccagctgtgtggccactggtatctgcgctgctgcgggttcgattacgac
atcgtcccgaaagaaaacgtccgaacggctctgaagaccatctacgacaacaatgtgatg
cggttctgcggaggcaacatgggcgccgtcaacggttacatcccgagcagccagcccaac
aaggacggtcgggcggacagctctacactgcaagccgaagaggtgtggaccggggtaacg
tacgccctggcctcgaccatgattcacgagggcatgtttacggaagcgttccagacggcc
ggaggcctctaccaaacgctttcagagaagattggcatgagctttgaaacgccggaagcg
ctgtacgcggaacggcactaccgagccatcggctacatgagaccgctcagtatttggtca
atgcagaccgcttgggaacaaaagaaacaaaatagggactaa

DBGET integrated database retrieval system