KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004787Help
Entry
CpipJ_CPIJ004787  CDS       T01079                                 

Definition
FKBP12-rapamycin complex-associated protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    CpipJ_CPIJ004787
Protein kinases [BR:cqu01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [Table]
   CpipJ_CPIJ004787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 2467 aa AA seqDB search
MSNSVQQFVNGLKSRNKDTQNKTAQELSLYVKTELREMPYDDLMAFFEDFNHHIFEMLSS
ADTNDKKGGVLAINCLISGDVVNTTTQISRYSNNLRQLLPSSDICVMELAAKVLVKLALL
PGSKGAESFEFDIKRAFEWLTEERTEPKRHAAVLILRELAVAMPTFFYQQVGSFFDHIMV
AIKDPKPMIREGAGQALRAVLIVTSQREGTKQNNNPQWYNHCYDSAMECFNEVPTREKGF
SRDDRIHGAMIVFNEILRSSNSAWEKKYIQLESLNVDRRARPTEDGHGIFPRIRVPFMDK
LSGSSGGSGYSSRYHDSSDMKFFRQNSSIQESALCRALVNDNYDLICQKVMEQRVSKSPY
VMQTLLTILPRLAAFNRREFVEKHLKSVVSYLIGTLKSKERERNLAFVTLGYIAVAVEKE
MERYVKRIMEVITAALPSRDTPSKKKPAVDPSVFMCITLLGHALKSAITSDVSKILASML
STGLSTGLTVCLHELCENVPQVKQDITSGLLKILSCVLMNKPLQPWQPTKTQSAINTNVY
EQHVQDTPTTVLALRTLGTFNFEGHSLLPFVQRCADHFLVSEQQEIRIEAVQTCTLLLKL
ALQSVDSADGSETLTQTVGNVLEKILIVGITDVDPNVRLRVLKSLDDSFDSQLAQPWFLS
SLLITMNDEVFEIRELAIIIIGRLSAINPAYVMPSLRKTMVQILTELEHSGMSRNKEQSA
RMLDHLIVSTPRLISSYMRPILTILVPKLKEPESNPGVMLNVLRAIGDLAEVNGGQQVLE
NWSDELLATLLEMLSDAGSTDKRAVALWTLGQLVSATGQAVSPYHKYPNLIDILINFLKT
EQQSYVRRETIRVLGLLGALDPYKHKMNRGLIDSQTNNILISISDTKTEEYTDLSTSEML
INMGNQLEEYYPAVAISTLMKILRDPTLSAHHISVVQAITFIFKSLGIKCVPYLSQVLPS
LLGNIRNAEMNLKEFLFQQLSILIEIVKQHIISFMDEIFQLIKTFWNSNYPLQSTLIILV
EKIAIALGCEFKIYLPQLMPQILRVLLHDNSTNRVVTVKLLSALQKFGNNLDDYLHLIIP
AVVKLFEPIDVPFAVSLAALETINYLAEILDFTDFSSRIIHPLVRVLDNHPGQLQTAALQ
TLCSIMIQLGKKYLVFVPLVNRVMIKHKISYTEYNKLLTKLQSSTTLALDDEFRLRQARF
KNRELSLASDTTIRKLNVSTVDLQLAFKANRRVSKDDWLEWLRRLSNGLLKESKSPALRS
CRTLAQNYPQLLKDLFNAAFVSCWTDLPDNLKEELSSSLRQALMVPDLPEITQTILNLAE
FMEHCENDSLRIDPKILGERAMECRAYAKALHYKEEEFHNMTEKDHAVFESLILINNKLQ
QKEAAEGLLEYAMEHRSASEEMKVQVRWYEKLHSWEKALSLYEEKLVANANDLESRLGQM
RCLEALGEWSSLHTLTKDKWEVLGNEGQSKAGRLAAAAAWGLRDWEGMHEFVKFIPEDTQ
DGSFYRAVLAVHHGEYELAQTLIDDTRDLLDTELTAMAGESYERAYGAMVCVQMLAELEE
VIQYKLIPERQETIKQMWWDRLLGGQRLVEDWQRILQVHSLVVNPANDVRTWLKFASLCR
KSGSLKLSEKTLVMLLRYDPSEFPEHALQHSEPDISFAYTKHMWMAGQRKRAYDQLNSLV
ADMSAEKNFETEEKDENRRLLARCYMKLGQWQNQLQGLNEQSIRGILACYEKATKHDSNW
YKAWHLWAYMNFEVVQNQKQQEDLQKNPGGDKEKCMIKQYAVPAVEGFFRSINLSQGNSL
QDTLRLLTLWFDYGQYPKVFDALVEGMRMIEINTWLQVIPQLIARIDTPRNLVGELIHQL
LNDIGKCHPQALVYPLTVASNSASSARRQAAHKILGSMGEHSSTLVNQAIMCSEELIRVA
ILWHEQWHEGLEEASRLYFGERNIKGMFETLEPLHQMLQRGPQTLKETSFNQAYGRDLNE
AQEWCKHYKNSGNIRDLNQAWDLYYHVFRRISRQLPQLTSLELQYVSPKLLACRDLELAV
PGSYTPGQELIRIASIQSNLQVITSKQRPRKLCIRGSNGKEYMFLLKGHEDLRQDERVMQ
LFGLVNTLLLNDPDTFRRNLTIQRYAVIPLSTNSGLIGWVPHCDTLHTLIRDYRDKKKTM
LNIEHRIMLRMAPDYDHLTLMQKVEVFEYALELTKGDDLAKLLWLKSPSSEVWFDRRTNY
TRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLT
RMLINAMEVTGIEGTYRRTCESVMHVLRRNKDSLMAVLEAFVYDPLLNWRLLDADKNRRS
KNATDVDSTTESMEETLDLLTINARNLRMNEANTAATAAAAAAAAAAAGGGDAGVGGIDQ
GSNCVANPAEATNNKARAIVDRVKQKLTGKDFNTAEVDVQRQIDLLIQQATNNENLCQCY
IGWCPFW
NT seq 7404 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaactcggtgcagcagtttgtgaacgggctgaagagccgcaacaaggacacgcag
aacaagacggcccaggagctgtcgctgtacgtcaagacggaactccgggagatgccgtac
gatgatttgatggcgtttttcgaggattttaatcaccacattttcgagatgctttcgagc
gccgacacgaacgacaagaaggggggcgtgctggccataaattgcctcatcagtggggac
gtggtcaacacgacgacgcagatttcgcgctattcgaacaatttgcgccagctgctgccg
tcgagcgacatttgcgtgatggagctggcggcgaaggtgctggtcaagctggccctgctg
cccggttcgaagggtgcggaatcgttcgagttcgacatcaaacgtgccttcgagtggttg
acggaggagcggacggagccgaagcggcacgccgcggtgttgatcttgcgggagttggcg
gtggccatgccgacgttcttctaccagcaggtgggaagcttcttcgaccacattatggtc
gcgatcaaggacccgaagccgatgatccgcgagggagcgggtcaggcgttgcgtgccgtg
ttgattgtgacctcgcagcgcgaggggacgaagcagaacaacaacccgcagtggtacaac
cactgttacgacagtgcgatggagtgcttcaacgaggtgccgacgcgggagaagggtttt
agccgggacgaccggattcacggtgcgatgattgtgtttaacgaaattttacggagctcg
aattcggcgtgggagaagaagtacatccaactggagagtttgaacgttgatcggagggcg
cgtccgacggaggacggacacgggatattcccgcgcattcgggtgccgtttatggataag
ctgagcgggtcgagcggtggttccgggtacagttcccgataccacgacagtagcgatatg
aaattcttccggcagaacagctcgattcaggagtcggcgctgtgtcgggcgttggtcaac
gacaattacgacttgatctgtcagaaggtgatggagcagcgcgtttccaagtctccgtac
gtaatgcagacgctgctgacgatactgccgcggctggccgcgttcaacagacgagagttt
gtggaaaagcacttgaagtccgtcgtgagttatttaatcggaacgttgaagagcaaggag
agagaacggaatttagcatttgtaacgcttggatatattgcggttgcggttgaaaaagaa
atggaacgttacgtcaaacggataatggaagtaattacagctgcccttccgtcaagagac
acccctagcaagaagaaaccagccgtcgacccgtccgtgttcatgtgtattacgctgctc
ggtcacgcgctcaaatcagccatcacttcggacgtttccaaaatcctcgcctcgatgctt
tcaaccggactcagcaccggcctgaccgtctgcctgcacgaactctgcgaaaacgttccc
caggtcaagcaggacatcaccagcggcctcctcaaaatcctatcctgcgtcctcatgaac
aaaccccttcaaccgtggcaaccaaccaaaacccagtccgcgatcaacacgaacgtgtac
gagcagcacgtgcaggacactccgacgacggtgctggcgctgcgaacgctcggcacgttc
aactttgaagggcacagcttgctcccgtttgtgcagcgctgcgcggatcatttcctggtc
agcgagcagcaggagatccgcatcgaggcggtccagacgtgcacgctgctgttgaagctc
gcgctgcagtcggtggactcggcggacggttcggaaacgctcacgcaaaccgtgggaaac
gtgctggagaagatcttgatcgtgggaattacggacgtggatccgaatgtgagattacgc
gtgttgaagtccctcgacgatagcttcgactcgcagctggcgcaaccttggtttttgagt
tcgctgctgatcacgatgaacgacgaagtgtttgagattcgcgagctggcgatcatcatc
ataggtcgcctatcggcgatcaacccagcgtacgtgatgccgagtctgcgcaagacgatg
gtgcagatattgacggagctggagcactccgggatgagtaggaataaggagcagagcgcg
cgcatgttagaccacctgattgtgagtacgccgcggctgatttcctcgtacatgcggccg
attctgacgattttggtgccgaagctgaaggagccggagtcgaatccgggcgtgatgttg
aacgtgctgcgggcgatcggagatttggcggaggttaatggggggcagcaggtgctggag
aattggtcggacgagctgttggccacgctgctggagatgttgagcgatgccggatcgacg
gacaagcgtgccgttgcgttgtggactcttggacagttggtgagcgcgaccggacaggcc
gtttccccgtaccacaaatacccgaacctgatcgacattctgatcaacttcctcaaaacg
gagcagcaatcgtacgtacgacgtgagacgattcgcgtcctcggcttgctaggcgccctc
gatccgtacaagcacaaaatgaaccgtggcctgatcgacagccaaaccaacaacattctg
atatccatctcggacaccaaaaccgaagaatacaccgacctgtcaacctcggaaatgctc
atcaacatgggcaaccaactggaggaatactacccggccgtggctatctccaccctgatg
aagatcctgcgcgatccaaccctctccgcgcaccacatcagcgtcgtccaagcgatcacg
ttcatcttcaaaagcctcggcatcaagtgcgtcccgtacctgtcgcaagtcctccccagc
ctgctcggaaacatccgcaacgccgagatgaacctgaaagagttcctcttccagcagctg
tcgatcctgatcgagatcgtcaagcagcacatcatcagcttcatggacgagatcttccag
ctgatcaaaaccttctggaacagcaactacccgctgcagtcgaccctcatcatcctagtg
gaaaagatcgcgatcgcgctcggctgcgagttcaagatctaccttccccagctaatgccg
caaatcctacgcgtcctcctccacgacaactcaacgaaccgggtcgtcaccgtcaagctg
ctctccgcgctgcaaaagttcggcaacaatctggacgactacctgcacctgatcatcccg
gccgtcgtcaaactgttcgagccgatcgacgtccccttcgccgtgtccctagccgccctc
gaaaccatcaactacctggcggaaatcctcgacttcaccgacttctcctccagaatcatc
cacccccttgttcgcgtcctcgacaaccaccccggccagctgcaaaccgccgccctccaa
accctctgctcgatcatgatccaactgggcaaaaagtacctcgtcttcgtccccctcgtc
aaccgcgtcatgatcaagcacaaaatctcctacaccgagtacaacaaactcctgaccaag
ctccaaagcagcaccacgctcgccctggacgacgagttccgtctccgccaagcccgcttc
aaaaaccgcgaactctcgctcgcctccgacaccacgatccgcaagctgaacgtctcaacc
gtcgacctgcagctcgccttcaaagccaaccgtcgcgtctccaaagacgactggctcgag
tggctccgccggctcagcaacggcctcctcaaagaatccaaaagcccggcgctgcgaagt
tgccgcaccctggcccaaaactacccccagctgttgaaggacctgttcaacgcggcgttc
gtgtcctgctggaccgacctgcccgacaacctgaaagaggagctctcctctagcttgcga
caagcgttgatggtccctgatctaccggaaatcacccagaccatcctcaacctcgccgag
ttcatggagcactgcgagaacgactcgctgcgcatcgacccgaagatcctcggcgaacga
gcgatggagtgtcgagcgtacgcgaaagccctccactacaaggaggaagagtttcacaac
atgacggagaaggatcacgccgtgttcgagtcgttgatcctgatcaacaacaagctgcag
cagaaggaggccgccgagggcctgctggagtacgcgatggaacatcgcagcgcgtccgag
gagatgaaggtccaggtgcggtggtacgagaagttgcacagctgggagaaggcactctcg
ttgtacgaggagaagctggtggcgaacgcgaacgacctcgagtcgcgactcggccagatg
cgatgtctggaggcgctcggagagtggtcttcgctgcacacgctcaccaaggacaagtgg
gaggtgctcgggaatgaggggcagagtaaggccgggagattggcggcggccgccgcttgg
ggcttgcgcgattgggaaggaatgcacgagtttgtcaagtttatccccgaggacacgcag
gacgggtcgttctaccgggcggtgctcgccgttcaccatggcgagtacgagctggcgcaa
acgctgatcgatgacacgcgcgacctgctcgacacggagctgaccgcgatggctggggag
tcgtacgagcgcgcgtacggagcgatggtgtgcgttcagatgctggcggaactcgaggaa
gtcatccagtacaagctgatccccgaacggcaggaaacgatcaagcagatgtggtgggat
cgcctcctgggcggtcaacgactcgtcgaagactggcaacgcatcctgcaggttcactcg
ctggtcgtcaacccggcgaacgacgtccggacgtggcttaaattcgcctcgctgtgtcgc
aagagcggatcgctcaagctctccgagaagaccctagtcatgctcctccggtacgatccc
tccgaattccccgaacacgccctccagcacagcgagccggacattagcttcgcctacacc
aagcacatgtggatggccggccaacgaaagcgcgcctacgaccaactcaactccctcgtc
gcggacatgagcgccgagaagaacttcgaaaccgaagaaaaggacgaaaaccgccgactg
ctcgcccgctgctacatgaagctcggccagtggcagaaccaactccaaggactcaacgag
cagtccatccggggcatcctcgcgtgctacgaaaaggccaccaagcacgactccaactgg
tacaaggcgtggcatctctgggcctacatgaacttcgaggtcgtccaaaaccaaaagcag
caggaagacctccagaagaaccccggcggagacaaggaaaagtgcatgatcaagcagtac
gccgtccccgccgtcgaaggcttcttccgctcgatcaacctctcccaaggcaactccctc
caggacaccctccgtctcctcaccctctggttcgactacggccaataccccaaagtcttt
gacgccctcgtcgagggcatgcgcatgatcgagatcaacacctggctccaggtcatcccc
cagctaatcgcccgcatcgacaccccgcgcaacctcgtcggagaactcatccaccaactc
ctgaacgacatcggcaagtgtcacccgcaagccctcgtatacccactaactgtggcctcc
aactccgcctcgagcgcacgtcgccaagcggcccacaagatcctcggctcaatgggcgaa
cactcgtccaccctggtcaaccaggcgatcatgtgcagcgaagagttgattcgggtggcg
attctgtggcacgagcagtggcacgaagggttggaggaggcatcccggctgtactttggc
gagcggaacatcaaggggatgttcgagacgctggaaccgttgcaccagatgttgcagcgc
ggaccgcaaacgctgaaggagacgtcgttcaaccaggcgtacggacgggatttgaacgag
gcgcaggagtggtgcaagcattataagaactccggcaacatccgcgatctgaaccaagcg
tgggacctgtactaccacgtgttccggcggatctcccgccaactgccgcagctgacctcg
ctggagctgcagtacgtgagtccgaagttgctcgcttgtcgcgacctggagctggccgtc
cccggaagttacacccccgggcaggagttgatccgcatcgcgagcatccagtcgaacctg
caggtcatcacgtcgaagcagcgtccgcggaagctgtgcattcgcggttccaacggcaag
gagtacatgtttttgctgaagggtcacgaagatctgcgccaggacgaacgggtgatgcag
ctgtttgggctggtgaatacgctgctgctgaacgatccggacacgttccggcgcaatctg
acgatccagcggtacgcggtcattccgttgagcacgaactccgggttgattgggtgggtt
ccgcactgcgacacgctgcacacgctgatccgggactatcgggacaagaagaagacgatg
ctgaacattgagcaccggataatgctgcggatggcgccggattatgaccatttgacgttg
atgcagaaggtcgaggtgtttgagtacgcgctggagctgaccaagggcgatgatctggcg
aagttactgtggttgaagagtccctcgtcggaggtttggttcgatcggaggacgaattat
acgaggtcgttggcggtgatgtcgatggttgggtacattctcgggttgggagatcgccac
ccgtcgaacctgatgctggaccggttgagcggcaagattctgcacattgactttggcgat
tgctttgaggtcgcaatgacgcgcgaaaagttccccgagaagatcccgttccgcctgacc
cggatgctgatcaacgcgatggaggtcaccggcattgagggcacctaccggcgaacctgc
gaaagtgtcatgcacgtgctccgacgtaacaaggacagcctgatggccgtcctcgaggcg
ttcgtgtacgacccgttgctcaactggcgcctgctggacgcggacaagaaccgccgctcg
aagaacgccaccgacgtggacagcacgacggaaagcatggaagaaacgctcgacctgctg
acgataaacgcgcgcaatctccgcatgaatgaggcgaacacggcggcaacggcagcggcg
gccgcagcagcagcagcagccgcgggaggcggtgacgccggtgtcggaggaatcgaccag
ggcagcaactgtgtggcgaatccggccgaggccaccaacaacaaggcgcgggccatcgtg
gaccgcgtcaagcagaagctcaccggcaaggactttaacacggccgaggtggacgtgcag
cggcagatcgatctgctgattcagcaggccaccaacaacgagaatctgtgccagtgctac
atcgggtggtgtccgttttggtag

DBGET integrated database retrieval system