KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004795Help
Entry
CpipJ_CPIJ004795  CDS       T01079                                 

Definition
mitochondrial carrier protein
Orthology
K15116  
solute carrier family 25, member 33/36
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 441 aa AA seqDB search
MTARGQSMTDFSHPDLLDVIREVGAQTVWNYIAGTAGAVVTCPLEVVKTRLQSSSASFIS
VPPRIVTDHHGVGKLSSSSCGSNEHLRSNSNSAEHHSRQRVCASTLLSRRRPSILAIPQC
GLSTSVQSISIWQCLKHIVQTEGGRALFKGLGPNIVGVAPSRAIYFCAYSKAKNALNTVG
IIPANSPLVHIMSASCAGFVSATLTNPIWFVKTRLQLDYNANAKQSVSECVRRIYATQGL
TGFYKGITASYVGISETVIHFVIYEALKKKLNEMRDTSPGDDKTSRDFLEFMAAGATSKT
IASVVAYPHEVARTRLREEGNKYRSFWQTIHTVWKEEGKAGLYRGLGTQLVRQIPNTAIM
MATYEAVVYVLSNQFNNPAGNLMADGGGTDTGYRFPALATLLERARAAEEEEDVTSGTTT
FEVELESAFIVHCISDFFVDL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccgtggacagtccatgaccgatttcagtcatccggatttgttggacgtcatt
cgggaggtcggcgcgcaaacagtttggaactatatcgcaggtactgctggcgccgtggta
acatgcccgctggaagtggtcaaaacgcgtctccaaagttcgtccgcctcgttcatcagc
gtgccgccgcgtatcgtgaccgatcatcacggcgtcggtaagttgtcctcgtcgtcgtgc
ggatcgaacgagcatctgcgcagcaacagcaactccgccgagcaccattccagacagcgg
gtatgcgctagcacgctgctgagccgccgccggccatcgatcctcgccatcccgcagtgt
ggcctctcgacgtcggtccagtcgatctcgatctggcaatgcctgaagcacatcgtccaa
accgagggcggtcgcgccctgtttaagggcctcgggcccaacattgtcggcgtggcgccg
tcccgtgcgatctacttttgtgcgtactccaaggccaaaaatgcgctgaacacggttggc
atcatcccggccaactcgccgctcgtgcacatcatgagtgcgtcctgcgccggcttcgtg
tccgccacgctcaccaacccgatctggttcgtcaagacgcgcctccagctggactacaac
gccaacgcgaagcagtccgtgtccgagtgcgtacgccggatctacgcgacgcagggtctg
accgggttctacaagggcatcaccgccagctacgtcggaatctccgagacggtcatccac
tttgtgatctacgaggcgctcaagaagaaactgaacgagatgcgcgacaccagccccggc
gacgacaagacttcccgcgactttctggagtttatggcggctggggcgacctccaagacg
atcgcgtcggtggtggcgtacccgcacgaggtggccaggacccggttgcgcgaggagggc
aacaagtaccgcagcttctggcagacgatccacacggtgtggaaggaggagggcaaggcg
ggactgtaccgtggcctcggaacgcagctggtccggcagatcccgaacacggccatcatg
atggccacgtacgaggccgtcgtgtacgtgctgtccaaccagttcaacaacccggccggc
aacctgatggccgatggtggcggaaccgatactggctatcggttcccggcgctggccacg
ctgcttgaacgcgctcgcgctgccgaggaggaggaagacgtcacctcggggactaccacc
ttcgaggtcgagctcgagtcggcgttcattgtacattgtattagtgatttcttcgtagat
ctgtaa

DBGET integrated database retrieval system