KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004855Help
Entry
CpipJ_CPIJ004855  CDS       T01079                                 

Definition
cyclin-H
Orthology
K06634  
cyclin H
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CpipJ_CPIJ004855
  Replication and repair
   03420 Nucleotide excision repair
    CpipJ_CPIJ004855
Transcription machinery [BR:cqu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CpipJ_CPIJ004855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 333 aa AA seqDB search
MYPQSSQKKFWSFKTEQELQERRLLQNYNFIARHGAAMSEEQKAAFFLSADEERLLLKQY
ELQLKEFCKRFEPPMPKYVVGTAFHYFKRFYLNNSAMDYHPKEILATCVYLSCKVEEFNV
SINQFVANIKGDRSKAMDIILSNELLLMQELNYYLTIHNPFRPVEGFLIDIKTRCHMNNP
DRLRPGIEDFIDKTFLTNAILMYAPSQIALAAVLHAASKEQENLDSYVTESLFGAAEDKL
PVLIEAVKRIRSMVRTIELPQKDKVRQLEKKLEKCRNQENNPDSQIYKQRMKKMYEDEDE
AELMATSYHMNASDVSLEVSHLNSSNPANMSIE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtacccccaaagttcccagaaaaagttctggtcgttcaaaactgagcaggaactgcag
gagcgccggctgctgcaaaattacaactttatcgcgcggcatggtgccgcaatgagtgag
gagcaaaaggcggccttctttctgtccgccgacgaggagcgacttctgctgaagcagtac
gagctgcagctaaaagagttctgcaagcggttcgagcctccgatgccaaagtacgtcgtt
ggaaccgcctttcactacttcaagcggttctacctcaacaactctgcgatggactatcac
ccgaaggagatcctagccacgtgcgtttatctgtcctgcaaggtggaggagttcaacgtg
tcgatcaatcaatttgtggccaacattaagggtgaccgcagcaaggccatggacatcatt
ctgtcgaacgaactgctactgatgcaggagctgaactattacctcaccatacacaatcca
ttccggccagtcgagggattcctgatagatattaagacccgctgccatatgaacaacccg
gatcggctgcgccctgggatcgaggatttcatagacaaaaccttccttacgaacgccatc
ctgatgtacgccccctcgcagatcgccctggcggcggttctgcacgcggccagcaaggag
caggagaacctggacagctacgtcaccgagtcgctgttcggggcggccgaggacaagctg
ccggtgctgatcgaggcggtcaagcggatacggtcgatggtgcgcaccatcgagctgccc
cagaaggacaaggtgcgccagctggagaagaagctggaaaagtgccgcaaccaggagaac
aacccggacagtcagatctacaagcagcgaatgaagaagatgtacgaagacgaggacgag
gcggaactgatggcgacgtcctaccacatgaacgcgtccgatgtgagcttagaagtgtcc
cacctgaacagtagcaatccggcgaacatgtcaatcgagtaa

DBGET integrated database retrieval system