KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004899Help
Entry
CpipJ_CPIJ004899  CDS       T01079                                 

Definition
eukaryotic translation initiation factor 3 subunit 1
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CpipJ_CPIJ004899
Translation factors [BR:cqu03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    CpipJ_CPIJ004899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 241 aa AA seqDB search
MEEDWEQHGEKEEVPLPAKKPDANKWDGEDEEEEVKDSWEDEDELEEKKDEEKVETPKAK
PKKTLQQKIVEKEKQKHEEAERRRLEKEAENMTPEQKLAEKLRLQKLQEESDLKNALDTF
GVTTLAGGIDGMTPNTKEDFVELSDAIVKKLASYKSDPEYADFLEDLVTKLFAGLPSNNI
RKVKGILDNLYLEKQKLEKGDKPKKSKGGKVKARLKLDGENQNFDEYQPKYDDFDEYDDF
M
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggattgggagcaacacggtgaaaaggaagaggttccacttccggccaagaaa
ccagatgccaacaaatgggacggcgaggacgaggaggaggaggtcaaggacagctgggag
gatgaagacgagctagaggaaaagaaagacgaggaaaaggtggaaactcccaaggcaaaa
ccgaagaaaacgttgcagcaaaagattgttgaaaaagagaaacaaaaacacgaggaagcc
gaacggaggcggctcgaaaaggaagcggaaaacatgacccccgaacagaagctggccgag
aagctgcggctacagaagctgcaggaagagtccgacctgaagaacgccctggacacgttc
ggcgtgacgacgctggccggcggaatcgacggcatgacgcccaacaccaaggaggacttt
gtcgagctgtcggacgccatcgtcaagaagctggccagctacaagagcgatcccgagtat
gcggactttctggaagatctggtcacgaagctgtttgccggcttgccgtccaacaacatt
cggaaagtgaaaggaattttagacaacctctatctggagaagcaaaagttggaaaagggt
gacaagcccaagaagagtaaaggcggtaaagttaaggctcggctaaagctcgacggtgaa
aatcaaaactttgatgaataccagcccaagtatgacgactttgacgagtacgacgacttt
atgtaa

DBGET integrated database retrieval system