KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004910Help
Entry
CpipJ_CPIJ004910  CDS       T01079                                 

Definition
serine/threonine kinase NLK
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:cqu04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:cqu04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 377 aa AA seqDB search
MWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPHLDF
FQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLL
VNSNCVLKICDFGLARVEEPDQSKHMTQEVVTQYYRAPEILMGARHYSAAVDVWSVGCIF
GELLGRRILFQAQSPVQQLELITELLGTPTLEDMRHACEGARTHMLRRAPKPPSLSALYT
LSTHATHEAVHLLCQMLVFDPDKRISVIDALAHPYVDEGRLRYHSCMCKCCYTPSAGMRQ
YAAEFEPSAQQPFDDLWERKLTSVQQVKEEMHKFIAEQLQTGRVPLCINPQSAAFKSFAS
STVAHPSELPPSPHQWE
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtgggctgtcacagatccgcgcgatgggcggcgggtcgcactcaagaaactgccaaac
gtgttccagtcgctcgtgtcatcgaagcgggtgttccgcgagctcaagatgctgtgcttc
ttcaagcatgaaaacgtattatcagccctcgacatcctgcagccaccacatttggatttc
ttccaagaaatctacgtcatcaccgaactgctccagtcggatctgcacaaaatcatcgtc
tcaccacagcacctctcggcggaccacatcaaggtgttcctgtaccagatcctgcgcgga
ctcaagtatctgcactcggcgcgcatcctccaccgggacatcaagccgggcaacctgctc
gtcaacagcaactgcgtactgaagatctgcgactttggcctggcccgcgtcgaggagccc
gatcagtccaagcacatgacccaggaggtggtcacacagtactaccgggcgccggagatc
ctgatgggtgcccgccactactccgctgccgtggacgtgtggtccgtggggtgcatcttt
ggcgagctgctcggccgccgcattctgttccaggcccagagcccggtgcagcagttggaa
ctgatcacggaactgctcggcacgcccactctggaggacatgcgacacgcctgcgagggc
gcccgaacccacatgctgcgccgcgccccgaagcctccgtcgctgtccgctctgtacacg
ctcagcacgcacgccacccacgaggcggttcacctgctctgccagatgctcgtctttgat
ccggacaagagaatctcggtgattgacgcgttggcccacccgtacgtggacgagggccgc
cttcggtaccattcctgcatgtgcaagtgctgctacacgccgtcggcgggcatgcgccag
tacgcggccgagtttgaaccgtcggcgcagcagccgttcgacgatctgtgggagcgcaag
ctgacctcggtgcagcaggtgaaagaggaaatgcacaaattcatcgcggagcagctgcaa
accggtcgcgtgccactatgtataaatcctcagagtgccgccttcaagagcttcgccagc
tccaccgtggcgcacccctcggagctgccgccctcgccccaccagtgggaatga

DBGET integrated database retrieval system