KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004991Help
Entry
CpipJ_CPIJ004991  CDS       T01079                                 

Definition
peptidyl-prolyl cis-trans isomerase
Orthology
K03768  
peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 201 aa AA seqDB search
MKLFVVLSVLLVGALASDGPKVTDKVFFDITIGGKPEGRIVIGLFGGTVPKTARNFKELA
EKTTVGEGYKGSKFHRVISDFMIQGGDFTRGDGTGGRSIYGERFADENFKLKHYGAGWLS
MANAGKDTNGSQFFITVKATSWLDGRHVVFGKVVEGMDVVRKIEKTATDGRDKPVQDVVI
ADSGSLPVDTPYAVEKADARD
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtttgtggtgcttagtgtgctgctcgtcggagccctggcctcggatggaccc
aaagtcactgataaggtgttctttgacatcaccatcgggggcaagccggaaggtcggatc
gtgatcggtctgttcggtggcaccgtcccgaagacggcccgcaacttcaaggagctggcc
gagaagaccaccgtcggcgaaggctacaagggcagcaagttccaccgcgtcatctcggac
tttatgatccagggtggagactttacgcgcggcgacggaaccggcggacggtccatctac
ggcgagcggttcgccgatgagaacttcaagctgaagcactacggcgccggatggctgtcg
atggcgaacgccggcaaggacaccaacggatcgcagttcttcatcacggtcaaggcgacc
agctggctggacggacgccacgtcgtgttcggcaaggtggtggagggcatggacgtcgtg
cggaagatcgaaaagaccgccaccgacggtcgggacaagcccgtccaggacgtggtcatc
gccgacagtggctcgctgccggtggacacgccgtacgccgtggagaaggccgatgcgcgc
gattag

DBGET integrated database retrieval system