KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ004991Help
Entry
CpipJ_CPIJ004991  CDS       T01079                                 

Definition
peptidyl-prolyl cis-trans isomerase
Orthology
K03768  
peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     CpipJ_CPIJ004991
Chaperones and folding catalysts [BR:cqu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    CpipJ_CPIJ004991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 201 aa AA seqDB search
MKLFVVLSVLLVGALASDGPKVTDKVFFDITIGGKPEGRIVIGLFGGTVPKTARNFKELA
EKTTVGEGYKGSKFHRVISDFMIQGGDFTRGDGTGGRSIYGERFADENFKLKHYGAGWLS
MANAGKDTNGSQFFITVKATSWLDGRHVVFGKVVEGMDVVRKIEKTATDGRDKPVQDVVI
ADSGSLPVDTPYAVEKADARD
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtttgtggtgcttagtgtgctgctcgtcggagccctggcctcggatggaccc
aaagtcactgataaggtgttctttgacatcaccatcgggggcaagccggaaggtcggatc
gtgatcggtctgttcggtggcaccgtcccgaagacggcccgcaacttcaaggagctggcc
gagaagaccaccgtcggcgaaggctacaagggcagcaagttccaccgcgtcatctcggac
tttatgatccagggtggagactttacgcgcggcgacggaaccggcggacggtccatctac
ggcgagcggttcgccgatgagaacttcaagctgaagcactacggcgccggatggctgtcg
atggcgaacgccggcaaggacaccaacggatcgcagttcttcatcacggtcaaggcgacc
agctggctggacggacgccacgtcgtgttcggcaaggtggtggagggcatggacgtcgtg
cggaagatcgaaaagaccgccaccgacggtcgggacaagcccgtccaggacgtggtcatc
gccgacagtggctcgctgccggtggacacgccgtacgccgtggagaaggccgatgcgcgc
gattag

DBGET integrated database retrieval system