KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ005086Help
Entry
CpipJ_CPIJ005086  CDS       T01079                                 

Definition
glycogen synthase
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CpipJ_CPIJ005086
Enzymes [BR:cqu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CpipJ_CPIJ005086
Glycosyltransferases [BR:cqu01003]
 Polysaccharide
  Storage polysaccharide
   CpipJ_CPIJ005086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 694 aa AA seqDB search
MSRRYSRVESGSDLLAFLDRGHSANTENRWTFEVAWEVANKVGGIYTVIRSKAFVSTEEL
GDQYCLIGPYKEASARTEVEACEFPSNGPLYAAVSEMRNQGFKVHCGRWLVDGNPQIILF
DLGSAAWKMDGYKHELWESSNVGIPHLDIESNDAVILGYTIATFIAEFKRCAEQYSRDNE
YGPPRIVAHFHEWQAGVGLIALRTRHVDVATVFTTHATLLGRYLCAGNTDFYNNLSKFPV
DEEAGKRQIYHRYCLERAATHLSHVFTTVSEITGYESEHLLKRKPDIITPNGLNVKKFSA
IHEFQNLHAMAKEKIHEFTRGHFYGHINFDLEKTLYMFIAGRYEFSNKGADIFIEALARL
NHLLKNQLPDVTVVAFLIFPAKTNNFNVESLRGHAVIKQLRETINSVQQQIGKRMYETCL
QGSLPDGNEILTKEDIVKIKRCLYSLQRDTNPPVTTHNIVDDWNDPVLDSVRRCHLFNTK
YDRVKIVFHPEFLNSTNPLFGLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITT
NLSGFGCFMHEHIADPKSYGIYIVDRRHVSVEESVQELSKYMFEFSKLNRRQRIIQRNRT
ERLSDLLDWRNLGIYYRQARIKALQTVYPDYVDESESYLKRASDFNYPRPVSAPPSPSSS
RHTTPAPSLHGSDDEQDSVDSEEELEELKKVNSH
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtcgctactcgcgcgtcgagtccggatcggacctgttggccttcctggaccgg
ggacactcggccaacaccgagaaccgctggacgttcgaggtcgcatgggaggtcgccaac
aaggttggtggaatctacacggttatccgctcgaaggcgttcgtgtctacggaggagctc
ggggatcagtactgcctgattggtccttataaggaggcgtccgcccgtaccgaagttgag
gcgtgcgagttcccgagcaatggtccgctgtacgcggccgtcagcgagatgcgcaaccag
ggcttcaaggtgcactgtgggcgctggctggtcgacggaaacccgcagatcattctgttt
gatctgggttcggccgcctggaagatggacggctacaagcatgagctgtgggagtcgtcc
aacgtaggaattccgcacctggatatcgagagcaacgatgctgttattctgggctacact
attgctacctttatcgcggagtttaagcgttgcgccgagcagtactcccgtgacaacgag
tacggaccgccacgtattgtggcacacttccacgagtggcaggcgggtgtgggtttgatt
gcgctacgtacccgccacgtggacgtggctacggtgttcacgacccatgcaaccctgctg
ggacgatatctttgcgcgggtaataccgacttctacaacaacttaagcaagttcccagtg
gacgaggaggcaggcaagcgtcagatctaccatcggtactgcctggaacgggccgccacc
catttatcgcatgtgttcacgacggtttcggagattaccggttacgagtcggagcatctg
ctgaagcgcaagccggacatcatcacgccgaacgggttgaacgtgaaaaagttttccgcg
atccacgagttccagaatctgcacgcgatggctaaggaaaagattcacgagtttactcgc
ggacacttttacggtcacatcaactttgacctggagaagacgctgtacatgttcattgcc
ggacggtacgagttttcgaacaagggtgctgacatcttcatcgaagcactggctcggttg
aaccacctgttgaagaatcagctacccgatgtcacggtggttgcatttttgattttccca
gccaaaaccaacaacttcaacgtggagtcgcttcgtggtcatgcggtcatcaagcagttg
cgcgaaaccatcaacagtgtacagcagcagattggaaagcgcatgtacgagacctgcctg
cagggttcccttcccgatggcaacgaaattctcaccaaggaagacatcgtcaagatcaag
cgttgtctgtacagcttgcaacgcgacaccaacccaccggtgaccacccacaacatcgtg
gacgactggaacgaccccgtgctggattcggtgcgcagatgtcacctcttcaacaccaag
tacgatcgcgtcaagatcgtcttccatccggagttcctcaactcaaccaatcctctgttc
gggctggactacgaggagtttgtgcgtggttgccatctgggcgttttcccctcgtactat
gaaccgtggggctacactccggctgagtgcaccgtaatgggcatcccgagtatcacgacc
aacctgtccggctttgggtgcttcatgcacgagcacatcgccgatcccaagtcgtacggt
atctacattgtcgatcggcgccacgtcagcgtcgaggagagcgtccaggaactgtccaag
tacatgtttgagttctccaagctcaaccggcgccaacgcatcatccagcgtaaccgtacc
gagcggttgagcgacctgctcgactggagaaatctgggaatctactatcgccaggcccgc
atcaaggccctgcaaacggtctacccggattacgtcgacgagtcggagtcgtacttgaag
cgcgcctccgatttcaactacccacgtccggtcagcgctccgccaagtcccagttcttcc
cgtcacaccacgccggctccctcgctgcacggttccgacgacgaacaggactcggttgac
tcggaggaggagctcgaagagctgaagaaggtcaactcgcactaa

DBGET integrated database retrieval system