KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ005303Help
Entry
CpipJ_CPIJ005303  CDS       T01079                                 

Definition
shaggy-like protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    CpipJ_CPIJ005303
   04350 TGF-beta signaling pathway
    CpipJ_CPIJ005303
   04068 FoxO signaling pathway
    CpipJ_CPIJ005303
   04150 mTOR signaling pathway
    CpipJ_CPIJ005303
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    CpipJ_CPIJ005303
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CpipJ_CPIJ005303
Protein kinases [BR:cqu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CpipJ_CPIJ005303
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CpipJ_CPIJ005303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 299 aa AA seqDB search
MLLFSTIYEWHANGVSLIIDIRDILRVPSIEQMKDVYIVQCLMETDLYKLLKTQRLSNDH
ICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPEHDHTGFLT
EYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLG
SPSQEDLECIINEKARSYLQSLPYKPKVPWSRLFANADPNALDLLGKMLTFNPHNRISVE
EALAHPYLEQYYDPADEPVAEEPFRIAMELDDLPKETLKRLIFEETLRFNHNDNLPDSM
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgttctcaacaatctacgagtggcatgcaaatggcgtttcgctcatcatagac
atacgagatatcctgcgggtgcctagcatagaacagatgaaagacgtatacattgtgcag
tgcttaatggagactgatctgtacaaactactgaaaacacagagactaagcaacgatcat
atctgctacttcctgtaccaaattctgcgaggtctcaagtacatccactcggcgaacgtc
ctgcaccgggatctgaagccgagcaacctgctgctgaacacgacttgtgatttaaagatt
tgtgatttcggcctggcacgggtagcggaccccgagcacgaccacaccggcttcctgacg
gagtacgtcgccaccagatggtaccgggcaccggaaatcatgctgaactccaagggttac
accaagtccatcgacatctggtccgtcggctgcatactggcggagatgctcagcaaccgg
cccatcttccccggcaagcactacctggaccagctgaaccacatcctcggcgtgctcggg
tcgccctcgcaggaggacctcgagtgcatcatcaacgagaaggcccgcagctacctgcag
tcgttgccatacaagccgaaggtgccctggtcgcggttgttcgcgaacgccgacccgaac
gcgctcgacctgctcggcaagatgctcacctttaacccgcacaaccggatctcggtcgag
gaggcgctcgcccacccgtacctcgagcagtactacgatcccgccgacgagcccgtggcc
gaggaaccattccgcatcgcgatggagctggacgatctgccgaaggagacgctgaagcga
ttaatcttcgaggaaacgctccgattcaaccacaacgataacctcccggatagcatgtaa

DBGET integrated database retrieval system