KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ005303Help
Entry
CpipJ_CPIJ005303  CDS       T01079                                 

Definition
shaggy-like protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - fly [PATH:cqu04013]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:cqu04350]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:cqu04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:cqu04150]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:cqu04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 299 aa AA seqDB search
MLLFSTIYEWHANGVSLIIDIRDILRVPSIEQMKDVYIVQCLMETDLYKLLKTQRLSNDH
ICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPEHDHTGFLT
EYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLG
SPSQEDLECIINEKARSYLQSLPYKPKVPWSRLFANADPNALDLLGKMLTFNPHNRISVE
EALAHPYLEQYYDPADEPVAEEPFRIAMELDDLPKETLKRLIFEETLRFNHNDNLPDSM
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgttctcaacaatctacgagtggcatgcaaatggcgtttcgctcatcatagac
atacgagatatcctgcgggtgcctagcatagaacagatgaaagacgtatacattgtgcag
tgcttaatggagactgatctgtacaaactactgaaaacacagagactaagcaacgatcat
atctgctacttcctgtaccaaattctgcgaggtctcaagtacatccactcggcgaacgtc
ctgcaccgggatctgaagccgagcaacctgctgctgaacacgacttgtgatttaaagatt
tgtgatttcggcctggcacgggtagcggaccccgagcacgaccacaccggcttcctgacg
gagtacgtcgccaccagatggtaccgggcaccggaaatcatgctgaactccaagggttac
accaagtccatcgacatctggtccgtcggctgcatactggcggagatgctcagcaaccgg
cccatcttccccggcaagcactacctggaccagctgaaccacatcctcggcgtgctcggg
tcgccctcgcaggaggacctcgagtgcatcatcaacgagaaggcccgcagctacctgcag
tcgttgccatacaagccgaaggtgccctggtcgcggttgttcgcgaacgccgacccgaac
gcgctcgacctgctcggcaagatgctcacctttaacccgcacaaccggatctcggtcgag
gaggcgctcgcccacccgtacctcgagcagtactacgatcccgccgacgagcccgtggcc
gaggaaccattccgcatcgcgatggagctggacgatctgccgaaggagacgctgaagcga
ttaatcttcgaggaaacgctccgattcaaccacaacgataacctcccggatagcatgtaa

DBGET integrated database retrieval system