KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ005334Help
Entry
CpipJ_CPIJ005334  CDS       T01079                                 

Definition
calcineurin subunit B
Orthology
K17610  
calcineurin B homologous protein 1
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Protein phosphatases and associated proteins [BR:cqu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     CpipJ_CPIJ005334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 189 aa AA seqDB search
MGNKSSLLLREEEITQIHEETGFTPNQIERLYSRFTSLDRSDCGTLSREDFLRIPELAIN
PLCERIVHSFFADSSDDRVNFRQFTQVLAHFRPIKPSKENKLNSREEKLRFAFKMYDLDD
DETISREELLSILHMMVGANISQDQLNSIAERTIVEADSMGQGKITFDDFCRALERTDVE
QKMSIRFLN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaaatcttcgctgctgctccgggaggaggaaattacgcaaattcacgaggaa
acgggattcaccccgaaccagatcgagcgcctgtactcgcgcttcacctcgctggaccgc
agcgattgcggaaccctgtcccgggaggacttcctgcgcatcccggagctggccatcaac
ccgctgtgcgagcgcatcgtgcactccttcttcgccgacagcagcgacgatcgggtcaac
ttccgccagttcacccaagtgctggcccacttccgaccgatcaaaccgagcaaggagaac
aaactcaacagccgggaggagaagctgcggttcgcgttcaagatgtacgacctggacgac
gacgagaccatctcgcgggaggagctgctgagcattctgcacatgatggtgggggcgaac
attagccaggaccagctgaacagcatcgcggagcggacgatcgtggaggcggactcgatg
ggccagggcaagattacgttcgatgatttttgccgcgcgctggagcgcaccgacgtcgag
cagaagatgagcattcgtttcctcaactga

DBGET integrated database retrieval system