KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ005343Help
Entry
CpipJ_CPIJ005343  CDS       T01079                                 

Definition
(RefSeq) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00511  Other glycan degradation
cqu00600  Sphingolipid metabolism
cqu01100  Metabolic pathways
cqu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CpipJ_CPIJ005343
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CpipJ_CPIJ005343
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    CpipJ_CPIJ005343
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     CpipJ_CPIJ005343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 6036791
NCBI-ProteinID: XP_001846785
VectorBase: CPIJ005343
UniProt: B0WDK1
AA seq 539 aa AA seqDB search
MPHLNLIAACALLWAAGSASLTAGASLPCALRQYPSGSVCVCNATYCDTLEFEEPKVAGE
FVLVSSGRDGARFREARGRFVNASRVEFLPVVMRTNGRRVVRATREVTVTVNRGRKFQRV
VGFGGAFTGAVAYNLGLLKPELRKSLYRSYYSKKVGIGYNLMRIPIGGCDFDLKPWAYNE
VPVDDVGLSNFTKLDDRDVVKIAQIKELMEVAENRNVKIMGAAWSPPRWMKSNNDWSGSS
RLKTEYFQTWADYHIRYLQLMKDAGLDYWAISTGNEPMNAVIGFLFIRFMSLGWTAIEQG
KWVGENLGPALRNSAFKDVKLFAGDDQRYTFPWWFSQMDQGHANATQYLDGLAVHWYWDG
VTPAALLDQAAKQYPDKLLFNTEASLGDKPFQTHGPILGSWDRAESYITYILQDLQHSVN
GWIDWNLLLNEIGGPNYANNYVETAVVVNATSGEEVYKQPIFYGLGHFSRFITEGSMRLE
TISSDSGVIVVGFERSDKLTTLVFYNKKSTPCELTIKDPDRGTTQLRLEPKSVHSILYA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgccgcacttgaacttgatcgcagcgtgcgccctcctctgggccgctggatcagccagc
ttgaccgccggtgcgtcgctgccatgtgcgttacgtcagtacccgagcgggtcggtttgc
gtttgcaacgcgacctactgcgatacgttggagtttgaggaaccaaaggtggccggggag
tttgtgctggtgtcgagtggtcgggatggagcgaggtttagggaggcgagagggcgcttt
gtgaacgcgagtagggtggagtttttgccggtggtgatgaggacgaacgggcgaagggtt
gtgagggcgacccgggaggttacggttacggtgaatcgggggaggaagtttcagcgggtt
gttgggtttgggggtgcgtttacgggggcggtggcgtacaatttggggctgttgaagccg
gagttgagaaagagcttgtaccggtcgtattactcgaagaaggtggggatcgggtataac
ttaatgaggatcccgattgggggttgtgactttgacttgaagccgtgggcttacaatgag
gtgccggtcgatgatgtggggttgagcaacttcaccaagctggatgatcgggatgtggtg
aagatcgcgcagatcaaggagttgatggaggtggcggagaatcggaatgttaagatcatg
ggagcggcgtggagtccgccaaggtggatgaaatcgaataacgactggagtggatcgagc
cggttgaagacggagtacttccaaacgtgggcggattaccacattcggtatttgcagctg
atgaaggacgccgggttggactattgggcgatctcaacggggaatgaaccgatgaatgcg
gtgatcgggtttctgtttatacggtttatgagccttggttggacggctattgaacaaggc
aagtgggttggtgagaatctcggaccggcattgagaaattccgcatttaaagacgtgaaa
ctgtttgctggagatgatcaacggtacacgttcccatggtggttttcgcaaatggatcag
ggtcatgcaaatgctacccagtatctggacggacttgccgttcattggtactgggatggc
gtaacaccagctgcacttctcgatcaggccgccaagcaatacccagataagctgctcttc
aacaccgaagcttcgttaggggataaacccttccaaacacatggtccgatcctcggctcg
tgggatcgcgccgaatcctacataacctacatcctgcaagatcttcaacacagtgtcaat
ggatggatcgactggaacctgctgctgaacgagatcggtggtccgaactacgccaacaat
tacgtcgagacggccgtggtcgtgaatgcgacctccggtgaagaggtgtacaaacagccc
attttctacgggttgggtcacttttcacggtttattacggaaggatcgatgcggctggaa
accatcagcagcgattcgggcgtgatcgtggtaggctttgagcgcagcgacaagctaact
accttggtattttacaacaagaaatccacaccgtgcgagttgaccatcaaggatccggac
cgcggcacgacccagctgcggctcgaacccaaatccgtgcattccattctctacgcctaa

DBGET integrated database retrieval system