KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ005450Help
Entry
CpipJ_CPIJ005450  CDS       T01079                                 

Definition
lysozyme
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     CpipJ_CPIJ005450
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CpipJ_CPIJ005450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 148 aa AA seqDB search
MAVLQKIFALGVVILVVSSVGEAKKFDKCSLAKALQDNGFSKDSLPNWVCLIQNESAMDT
TKKNNNRNGSTDWGLFQINDRYWCDPQDKSKKTSNECKLKCSALLSDNISSAATCAKKIW
KRHGYRAWYGWINRCEGKTLPSLTSCKL
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggctgttttgcagaagatttttgcccttggggtggtaattttggtcgtgagttcagtt
ggtgaagcaaaaaagttcgacaagtgttcactggcgaaagctctgcaggataatggtttc
agcaaagacagtttaccaaattgggtctgcctgattcagaacgaaagcgcaatggatacc
accaagaagaacaacaaccgaaatggttcaaccgactggggactgttccagatcaatgac
cgatactggtgcgatccccaggacaaatccaagaagacctcaaacgagtgcaagctcaag
tgttcagctttactatcggataacatctcgtcggcggcgacctgcgcgaagaaaatctgg
aaacgacacggttacagggcctggtacgggtggatcaaccggtgcgagggtaaaacgctg
cccagtctgacaagctgcaagttgtga

DBGET integrated database retrieval system