KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ005540Help
Entry
CpipJ_CPIJ005540  CDS       T01079                                 

Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    CpipJ_CPIJ005540
   04330 Notch signaling pathway
    CpipJ_CPIJ005540
   04350 TGF-beta signaling pathway
    CpipJ_CPIJ005540
   04630 Jak-STAT signaling pathway
    CpipJ_CPIJ005540
   04068 FoxO signaling pathway
    CpipJ_CPIJ005540
Enzymes [BR:cqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CpipJ_CPIJ005540
Transcription factors [BR:cqu03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    CpipJ_CPIJ005540
Mitochondrial biogenesis [BR:cqu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    CpipJ_CPIJ005540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 2883 aa AA seqDB search
MADHSDEPPHKRAKLRDEVNSSIDLMFDLESHLPDELMGDNTWGDALSGVGNKPPGPGPG
GPQMNGGGPGDDPGGTSAAMVNQMALRQQQLHQQQQQQQMHHIMQQQGNKGMVAGQQQQI
LGMGKSPNMLPMQQQQGMPPNNVVVGPMGGGGPGGMLGMNSIAQNNGGTIITNSNMGLSG
GMVTSGGLVINNNNNMKQGGPGNPGLMHQLPPNAMQNGPLNNRLGMPGQPGQHMTRVPGG
HMNQQGLRQLMQNHVGGGMGNQINQMGGPFGGYQQNVMTPGGMAPVRGSPPTMPNRMPNM
NMAGARMGNPLGAGNMLPGGAGLGGMNVVNEGGVAAQAQPPTPSPVQPSSGKPTAQIRPT
TAAQGGQQQQQPMGQQMNAGGGPGGATVVPTPGGQQQQQQQQQQQQQPGSTQSGPGNPLL
ADPEKRKLIQQQLVLLLHAHKCQRRESENPNSNNCTLAHCRTMKEVLTHMQSCQLGKNCP
KTHCSSSRQIINHWKNCQRQDCPVCLPLRDTNKYKQNQQQPGQQQQQQQQQNQQQQNQQN
QLKNQLQQDPNQPQQQQQQPGQPGQNQQANQQQQMPGGPFNQHVGGGNQVQCPSSTASNA
LPGNGPQMPNQQQQVGQPGMPGQQQQQAGQMAAMQRQMAQQQQQQQGGGVRMMIPPNQMM
VNNNSNVLPTSSGDASSGGLPVVTSQAGGSNQSVSQMAAALQQQQPNAQMQQQNQSQNII
PLPGNVLFNQDGGQQQQQPGGSGAAGAGNFPANQMIAAPVQGTKDWHHSVTPDLRNHLVH
KLVQAIFPSPDPSTMFDKRMYNLVAYAKKVEGDMYEMANSRSEYYHLLAEKIYKIQKELE
EKRQKRKEQQMQQQRQAAEAQQQQQLQQPGGNVQIRPMNPNQAMMNPVGMPGANNVMQMP
RQVGPNQLLNQNLLQQQQQQRMNLAAGQQQMFVSQPGPSPSGLGQQQTVLPGGLSPFTAQ
QQQQALNNHPPGMTPPSAQNAFLNGPSIADSSPSGLQQFNDIMKAKYNAGQAAAAAAAAN
SMGGMNQTVTPSLPSPFGNSQNNQTFNGAGQQQQQQQMGMGTNCLNNGQQQRTNNNSLQM
PSTPTSVGGDLLNSSGNSVPIPSPSPSLTPNGPLPRRTYSTTTTHLISHSDLDSAGTQRR
TQLSFHYQYCLERTHDDDVRKQRTAASTTSSATSTHTSSSNSISATSTTISNSSSSSAAI
SRSSSSALSSQMAALEAAARDDDDDSQPATGANNSGSESNAKGGKFEIKQEQDIKSEPDT
NHMDTSESGGQTGGKSVNNDNCPSIKQEIKTEPMDTADGGGEGSENKPNSKLDVVKCKEE
PMSPSGGSTANAVVKSEPRVCPEPVAQDATDTKKKCSFKPEELREALIPTLEKLVAQEPE
SIPFRMPVDPQGLGIPDYFDIVRKPMDLSTIRKKLDSGQYSDPWEYVDDVWLMFDNAWLY
NRKTSRVYRYCTKLSEVFEQEIDPVMQSLGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKY
YSYQNRYTYCQKCFNEIPGDMVTLGDDPMQTQTQIKKDQFKEMKNDHLELEPFLDCLDCG
RKQHQICVLYLEQIWPGGFVCDNCLKKKGTKRKDNKSNAKRLPTSKLGTYIETRVNNFLK
KKEAGAGEVHIRVVSSSDKMVEVKPGMRSRFVDNNEMLAEFPYRAKALFAFEEVDGIDVC
FFGMHVQEYGSECAAPNTRRVYIAYLDSVHFFQPRQYRTSVYHEILLGYMDYAKQLGYTM
AHIWACPPSEGDDYIFHCHPPEQRIPKPKRLQEWYKKMLDKGMVERTIQDYKDILKQAME
DKLQSASELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEREEAAANAIMSMNDDSDTGA
DGKKKGGQKKAKKSNKSKAAQRKNNKKSNEQIGNDLSAKIFATMEKHKEVFFVIRLHSAQ
SAASLAPIQDPDPLINCDLMDGRDAFLTMARDKHYEFSSLRRAQFSTLCMLYELHNQGQD
KFVYTCNNCKNHVETRYHCTVCDDFDLCITCKDKVGHQHKMDKLGFDLDDGSSPTDIKQT
NPQEARKQSIQRCIQSLVHACQCRDANCRLPSCQKMKRVVQHTKHCKRKTHGGCPICKQL
IALCCYHAKHCQEAKCLVPFCPNIKHKLKQQQLQQRLQQQQLLRRRMAVMNTTRMGTTST
PSIAASSGPSPLPSGGPSGGMSPGPNSMGGGAGPSPGGPGMGGGGGGGMGPGGMSGPGSV
GSVGSGMGIGPGGMVGTPGGGMSPSAAAPSPLGQVGGLGSPHGPAGMSGMKQESQPPPPN
VMQALKQVQEEAARQQAPHGSFGKGHPGGAPMPPPVMQRAIAAGGHMGGVGGVGPMGGVG
PQQQQPVGGVGPMGGPGGPGVGVVGAGGQNVMAQLDQWGNPRYPNAGGVQQNPGGMRPNL
PGMMQQGQGQGPQQPNPMQGGMMGAGVGGQQMMGGMRPGPGGGVCIQGPGGGMIPNQQQQ
VVGGPGQQPGAPGSQLPTNQPKAAIAQLMATLKNPQAGPEQQQQLLSILKANPQLMAAFI
KQRQQMNQNQQNQNQGGMPGQQQQQQQQGQQSQQQAMMQQHPGGVGVGVGGVGVGPGQQQ
QGVGVGPGQGPVVGGMGYNPAAGGGPMAPNRMQGGGVQGMAGGGKPGGGNPQMQQIPIQQ
QIWYKQQQQQQQQQQQQQQQHQQQMLLQRQLAMSGNNMQPAPPYQQRPRPQQQMGVGGYG
PGGGMFPDQQQQQQQQQYMQQGLKPGPGQQGPGGVNVLSQQLQQGPGGQVMGPPTPQHAM
QQQLMQTVRSPPPIRSPQPQPSPRAVPSPRGGGGGQPSASPRAQPSPHHMPSHSPAPSGG
DMHNHMHPHQSPGVGVGGVGGQGVPPGGDPNQMPGGGGGGGVGPNDTSPLNAQDQLTKFV
EQL
NT seq 8652 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcacagcgatgaaccgccgcacaagcgggccaagctgcgggatgaggtcaac
tcatcgatcgacctgatgttcgacctggagagccacctcccggacgagctgatgggcgac
aacacgtggggcgacgcgctgagcggcgtgggcaacaaaccacccggccccggtcccggt
ggcccccagatgaacggaggtggcccgggcgatgatccgggcggaacgtccgccgcaatg
gtgaaccagatggcactccgccagcagcagctgcaccaacaacagcagcaacaacaaatg
caccatatcatgcagcaacagggtaacaaaggcatggtggccggccagcagcagcagatc
ctcggcatgggcaagagtccgaacatgttgccgatgcagcaacagcagggaatgcccccg
aacaacgtcgttgtggggccgatgggcggcggaggccccggcgggatgctcgggatgaac
agtattgcgcagaacaacggaggcacgatcatcacgaacagtaacatgggactgagtgga
gggatggtgacgagtgggggacttgtgataaacaacaacaacaacatgaagcagggtggc
ccggggaatcctggcttgatgcatcagctaccgccgaatgcgatgcagaatgggccgttg
aacaacaggttagggatgccaggacaaccgggccagcacatgacgagggttccgggaggg
cacatgaaccagcagggcttgcggcagctgatgcagaatcacgtcggtggtggcatggga
aaccaaatcaaccagatgggcggccctttcggaggttaccagcagaacgtgatgaccccg
ggtggaatggccccagtgcgggggtcaccgcccacgatgccaaaccggatgccgaacatg
aacatggccggcgctcggatgggaaacccgcttggagcgggaaacatgctccccggtggt
gccggtcttggtggcatgaacgttgttaacgagggcggagttgcggcgcaagcgcaacct
ccaacgccatcgccggtgcaaccctcgtccggcaaacctaccgcccaaatccgaccaacg
acggccgcccaaggtggccaacagcaacagcagcccatgggccaacaaatgaacgccggt
ggaggccccggaggtgcaaccgtcgtaccaacgcccggtggtcaacaacagcagcagcag
caacaacaacaacaacagcaacctggctctacccaaagcgggcccggcaatccactgctc
gccgacccggaaaaacgaaaactcattcaacagcagctcgtcctgcttctgcacgcccac
aagtgtcagcggcgcgagtccgaaaaccccaacagcaacaactgcacgctagcgcactgc
cgaaccatgaaggaagtgctcacccacatgcagtcctgccagctcggcaaaaactgtccc
aaaacgcactgctcctcgtcgcggcagatcatcaaccactggaagaactgccaacggcag
gactgtccggtttgtttgcctctgcgcgataccaacaagtacaaacagaaccagcaacaa
cccggacagcagcagcaacaacaacaacaacaaaaccaacagcaacagaaccagcaaaac
caactcaaaaatcaactccagcaagacccgaatcagccacagcagcagcagcaacagccg
ggacaacccggccagaatcagcaagctaaccagcagcagcaaatgcccgggggtccattc
aaccaacacgtcggcggtggcaaccaagtgcaatgtccttcctcgaccgcgtccaacgcc
ctacccggaaacggtccccaaatgcccaaccagcaacaacaggtgggccaacccggaatg
cctggccagcagcagcagcaagccggtcagatggcggcgatgcagcgacaaatggcgcag
caacagcagcagcagcaaggtggtggcgtccggatgatgattccgcccaaccagatgatg
gtcaacaacaatagcaacgtactgcccaccagcagcggtgacgcgtccagtggagggctt
cccgtcgttaccagccaggccggtgggtccaaccaaagtgtaagccaaatggccgctgca
ttgcagcagcagcaaccaaacgctcaaatgcagcagcaaaatcaatctcaaaacatcatt
ccattgccggggaacgtgctgttcaatcaggacgggggccagcagcagcaacaacctggg
ggaagtggggcggccggcgcagggaacttccccgcgaaccaaatgattgcggcaccggtg
cagggcacgaaagactggcaccactcggtgacgcccgacttgcggaatcacctggttcac
aagctcgtgcaggccatcttcccctcgcccgatccgtcgaccatgttcgacaagcgcatg
tacaatctggtcgcgtacgcgaaaaaggtcgaaggagatatgtacgagatggcgaactca
aggtccgagtactatcacctgttggcggagaagatctacaagattcagaaggagctggag
gagaagcgacagaagcgaaaagaacagcaaatgcaacagcagaggcaagctgccgaagct
caacagcagcagcaactccagcaaccgggcggaaacgtgcagattcggcccatgaacccg
aaccaggcgatgatgaacccggtcgggatgcccggcgcgaacaacgttatgcaaatgccc
cgccaggttggaccgaaccagttgttgaaccaaaacttgctccagcagcagcaacagcag
aggatgaacctggccgcaggtcaacagcagatgttcgtatcgcaaccaggccccagtcca
agcggactcggccagcaacaaaccgtactgcccggtggcctgtctccattcaccgcccag
cagcaacaacaagccctgaacaatcacccgccgggaatgacgccaccttcggcgcaaaat
gccttcctgaacggaccctcgatagcggacagctcgcccagtgggctgcagcagttcaac
gacatcatgaaggccaagtacaacgcaggtcaagcggcggcagctgctgccgcggccaac
tccatgggtggcatgaaccaaaccgtgactccgtcactgccatcgcccttcggtaacagt
caaaacaaccaaaccttcaacggcgccggccagcagcagcagcagcagcagatgggaatg
ggcaccaactgtctcaacaatggccagcaacaacgcaccaacaacaacagcctacagatg
ccttcaactccgaccagcgtcggcggcgacctgctgaactcgtccggcaatagtgttcca
attccatcgccctcaccaagtctcaccccgaacggtccccttccgcgccggacctactcc
accaccaccacccatctcatctcccattccgatctcgactccgccggcactcagcgccgt
actcagctcagcttccattaccagtactgcctcgagcggacccacgacgacgacgtccgc
aagcagcgcactgccgctagcacaacttcgtccgcgacctccacacacaccagcagtagc
aatagtattagcgccaccagcactaccatcagcaacagcagcagtagtagcgccgccatc
agcaggtccagctcgtcggcgctcagctcgcagatggcggccctcgaagccgccgcacgc
gacgacgacgacgactcccagccggcgacgggcgccaacaactcgggcagcgagtccaac
gccaagggcggcaagttcgagatcaaacaggagcaggacatcaagtctgagccggacacc
aaccacatggacacgtccgagtcgggcggccaaaccggcggcaagagcgtcaacaacgac
aactgtcccagcatcaagcaggaaatcaagactgaaccgatggatacggccgacgggggc
ggcgagggcagcgaaaacaagcccaacagcaagctggacgtggtcaagtgcaaggaggaa
ccgatgtcgccgtccggcgggtccaccgcgaacgccgtcgtcaagagcgagccgcgcgtg
tgccccgagccggtggcgcaggacgcgacagacaccaagaaaaagtgttcattcaagccg
gaggagctgcgcgaggcgctcatcccgacgctggagaagctggtcgcgcaggaaccggaa
tcgatcccgttccgcatgccggtggatccgcagggcctgggcatcccggactacttcgac
atcgtgcgcaaaccgatggatctcagcacaatccggaagaagctcgactcgggccagtac
tccgacccgtgggagtacgtggacgacgtgtggctcatgttcgacaacgcgtggctgtac
aaccggaagacgtcccgcgtgtaccggtactgcaccaagctctcggaagttttcgagcag
gagatcgatccggtgatgcagtcccttggttactgctgcggccggaagtacacctttaat
ccccaggtgctgtgctgctacggcaagcagctctgcacgatcccgcgggatgccaaatac
tacagctaccagaaccgatacacgtactgtcagaagtgcttcaacgagatccccggcgac
atggtgacgctcggcgacgacccgatgcagacgcagactcaaatcaaaaaggaccagttc
aaggagatgaagaacgaccacctggagctggaaccgttcctcgattgtctcgactgtggc
cgcaagcagcaccagatttgcgtgctctacctggagcagatctggccgggtgggttcgtg
tgcgacaactgcctcaagaagaagggcaccaagcggaaagacaacaagtcgaacgccaag
cggctgccgacgtccaagctgggcacgtacatcgaaacgcgcgtcaacaacttcctcaag
aagaaggaggcgggcgcgggcgaggtgcacatccgcgtcgtgtccagctcggacaagatg
gtcgaggtgaagcccggcatgcggagtcggttcgtggacaacaacgaaatgttggccgag
ttcccgtaccgggccaaggcgctgtttgcgttcgaggaggtggacggcatcgacgtgtgc
ttcttcggcatgcacgtccaggagtacgggtcggagtgtgccgcacccaacacccggcgc
gtctacattgcctacctcgactcggtgcactttttccagccgcgccagtaccgaacttcc
gtttaccacgagattctgctcggctacatggactacgcgaagcagctcggttacacgatg
gcccacatctgggcgtgtccgccctccgaaggggacgactacatcttccactgtcacccg
ccggagcagcgaatccccaagcccaagcggctccaggagtggtacaaaaagatgctggac
aagggcatggtcgagcgcaccatccaggactacaaggacatcctgaagcaggccatggag
gacaagctgcagtcggcgtccgagctgccgtactttgagggtgacttttggccgaacgtg
ctcgaggagagcatcaaggagctggaccaggaggaggaggaaaagcgcaagcaggcggag
cgtgaggaggcggcggctaatgcgatcatgtcgatgaacgacgacagcgacacgggcgcg
gacggcaagaagaagggtggccagaagaaggcgaaaaaatcgaacaaatcgaaagccgcc
cagcgcaagaacaacaaaaagtccaacgagcagatcggcaacgatctcagcgcgaagatc
ttcgccacgatggaaaagcacaaggaggtgttcttcgtgatccggctgcactcggcccag
tcggcggcctcgctggcgcccatccaagatccggacccgctcatcaactgtgacctgatg
gacgggcgggacgcgttcctgacgatggcccgggacaagcactacgagttttcgtcgctc
cggcgggcccagttcagtacgctgtgcatgctgtacgagctgcacaaccagggccaggac
aagtttgtgtacacgtgcaacaactgcaagaaccacgtcgagacgcgctaccactgcacc
gtgtgtgatgactttgacctgtgcattacgtgcaaggacaaggttggtcaccagcacaaa
atggacaagctcgggttcgacctggacgatggctcgtccccgacggacatcaagcagacc
aatccgcaggaggcgcgcaagcagtccatccagcggtgcatccagtcgctggtgcacgcg
tgtcagtgccgagacgccaactgccggctgccgagctgtcagaagatgaagcgcgtcgtg
cagcacacgaagcactgcaagcggaagacgcacggcggctgtccgatctgcaagcagctg
attgcgctgtgctgttaccacgccaagcactgccaggaggccaagtgtctggtgccgttc
tgtccgaacatcaagcacaagctgaagcagcagcagctgcagcagagactgcaacagcaa
caactgctccgacggcgaatggccgtaatgaacacgacccgcatgggcaccacgtcgacg
ccttcgatagccgcctccagcgggccgagcccacttccgtcgggtggtcccagcggtggc
atgagcccgggcccgaacagcatgggcggtggcgccggtccaagtccgggtggtcccggc
atgggaggcggcggcggcggcggaatgggtccaggtggcatgagtggacccggcagtgtc
ggttccgttggcagcgggatgggcatcggtccaggcggtatggtgggaactcccggcggc
ggcatgagcccctcggccgcggcacccagtccgctgggtcaggtcggtgggctgggaagc
ccgcacgggccggccggcatgtccggcatgaagcaggagtcccagcctccgccgccgaac
gtgatgcaggcgctgaaacaggttcaggaggaggccgcacgacaacaagcaccgcacgga
agcttcggcaagggacacccgggtggggctccgatgccaccgcctgtgatgcagcgggcg
attgccgccggaggtcacatgggtggcgtaggcggagttgggcccatgggtggcgttggt
ccccagcaacagcaaccggtcggaggagtgggaccgatgggtggtccaggagggccggga
gttggcgttgtgggggccggcggtcagaacgtgatggcccagctggatcagtggggcaac
ccgaggtatccgaatgccggcggtgtccagcagaaccccggaggaatgcggccaaatctg
cccggcatgatgcagcagggccaggggcaggggccgcagcaaccgaacccgatgcagggg
ggcatgatgggcgccggcgtcggtggccagcagatgatgggtggcatgcggcccggaccg
ggtggtggcgtttgcattcagggcccgggaggcggaatgattcccaaccagcagcagcag
gtcgtgggaggcccgggtcagcagccgggagcgcccggttcgcaactgccaacgaatcaa
cccaaggccgccatcgcgcagctgatggcgacactcaagaacccgcaggccggacccgaa
cagcaacagcagctgctgtcgatcctgaaggcgaacccgcagctgatggcggccttcatc
aagcagcggcagcagatgaaccagaaccagcagaaccaaaaccagggtggaatgcccggc
cagcagcagcagcaacagcagcagggtcagcagagccagcagcaggcgatgatgcagcag
catccgggcggagttggcgttggagtgggaggagttggcgttgggccgggtcagcagcag
cagggtgtcggagttggtcccggacagggacccgtcgtcggtggcatgggctataacccg
gcggcgggcggagggccgatggcgcccaacaggatgcagggcggtggcgtccaggggatg
gccggcgggggtaaacccggtggcggaaacccgcagatgcagcagataccgatccaacaa
cagatatggtacaaacagcagcaacaacaacagcaacaacagcagcagcagcaacaacag
caccaacagcagatgctcctgcagcgccagctggccatgtccggcaacaacatgcaaccg
gcgccaccctaccagcaacgaccccggccccagcagcagatgggcgtcggtggttacggc
ccgggcggcggcatgttccccgaccagcagcaacaacagcaacagcagcagtacatgcag
cagggcctcaagcccggccccggccagcaaggtccgggcggcgtcaacgtactatcccag
caactgcagcagggcccgggcggccaagtgatgggtcctccgacgccgcagcacgcgatg
cagcagcagctcatgcaaacggtccgatcacctccgccaatccgatccccgcagccacaa
ccttcgccgcgagccgtcccatctccgcgaggaggcggcggtggtcaaccgtcggcttcc
ccgcgcgctcaaccctcgcctcaccacatgccgtcgcactcgccagcgccgagtggcggc
gacatgcacaatcacatgcacccccaccagagtccgggcgtgggcgttggcggcgtaggc
ggccagggcgttcccccggggggtgatccgaaccagatgccgggtgggggagggggaggc
ggtgttggccccaacgatacgagtcccctgaacgcgcaggaccagctgaccaagtttgtc
gagcagttgtag

DBGET integrated database retrieval system