KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ005543Help
Entry
CpipJ_CPIJ005543  CDS       T01079                                 

Definition
phosphatidylinositol 3-kinase 1
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CpipJ_CPIJ005543
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    CpipJ_CPIJ005543
   04068 FoxO signaling pathway
    CpipJ_CPIJ005543
   04070 Phosphatidylinositol signaling system
    CpipJ_CPIJ005543
   04150 mTOR signaling pathway
    CpipJ_CPIJ005543
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     CpipJ_CPIJ005543
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1021 aa AA seqDB search
MHVRQVSTMATDVWEEAERYPLYCHLGDKSMYYFSAMSATSTGCCELNDESKRLFEVQPL
FCMFRFVEKQVSVNNKLINNITTLLGKTLSEKTLKNPEVNDFRTKMSYLGEEIANKRAAM
NRMERIAYQYPPKLVTNKVLPELVKKRIVNGDFCVVAKSADMQVTVKIPCKATPDEVIKR
ILEKKQISANTRNENSFDFILKVCGREEYMFGDHPIINFQYVQDSLSREETPTFVPKLLR
NVEIFEDNIYEIPEDITHRTNSTGSKQMSHTLRKVKHITSWEVDTQFSCVVQEIADLNCD
ANRNVEVGIQLGLFHGGKSLCKPMKTQLVSLHKGRAAWNETIVFDINVKNVPRMARLCLV
IYENVRTAKGIGVRARRTKDGFMNPIAWVNTMLYDYKSQLKAGAVTLYTWTYAEDSQSED
VLHPLGTVEPNPRRDECSSMILCFEDYKQENKIIVYPSEDQLMKHAAKNRNCNRPLNRDS
AEEVRPIKEILMPYIHNDRLNDMHEQDRNAIWAKRRECKDLEPDGLPCLLYCVEWNNRNE
VAEITALLQEWPILPVERALELLDYAYADQYVRRYAVNCLRTIQDDELLLYLLQLVQAMK
HESYLYSDLVDFLLQRALNNQHIGHFFFWHLRSEFQFPSVQVRFGLILEAYLKGSQEHVA
ILLKQMQCLRKLQQGSELVKKGNKEKGKSLLIGHLQERASGEAMSDVISPLNPSFRCKSV
RADKCKVMDSKMRPLWIVYQNSDINGDDINIIFKNGDDLRQDMLTLQMLRIMDRIWKSHG
HDFRMNPYSCISTDRRLGIIEVVLNAETIANIQKERGMFSATSPFKKGSLLAWLKEHNTT
DEMLAKAVQEFTLSCAGYCVATYVLGVADRHSDNIMVKKTGQLFHIDFGHILGHFKEKFG
FRRERVPFVLTHDFVYVINKGRTDREAHEFREFQILCEEAFLILRKHGCLILSLFAMMIS
TGLPELSSEKDLNYLRETLVLDLPEAEAREHFKSKFSEALANSWKTSLNWASHNFSKNNK
Q
NT seq 3066 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtacgacaagttagcacgatggcgacggacgtctgggaggaagcggaacggtac
ccgctgtactgccacctgggcgacaagtcgatgtactacttcagtgccatgtccgccacc
agcaccggctgctgcgagctcaacgacgaaagcaaacgcctgttcgaggtgcagcccctc
ttctgcatgttccgcttcgtcgagaagcaggtgtcggtcaacaacaagctgatcaacaac
atcacgacgctgctgggcaagacgctgtcggagaagacgctcaagaacccggaggtgaac
gacttccgcaccaagatgagctacttgggcgaggagattgcgaacaaacgcgcggcgatg
aaccggatggagcgaatcgcgtaccagtatccgcccaagctcgtcacgaacaaggtgctg
ccggagctggtgaagaagcggattgtgaatggggacttttgcgtggtggcgaagagcgcg
gatatgcaggtgacggtgaagattccttgcaaggcgacgccggatgaggtgattaagcgg
atattggagaagaagcagatttcggcgaatacgaggaatgagaatagtttcgactttata
ctgaaggtgtgcgggagggaggagtacatgtttggggatcacccgatcatcaacttccag
tacgtgcaggattcgctgagtcgcgaggaaactccaacgttcgttcctaagctgttgcgg
aatgttgagatatttgaggataatatttatgaaataccggaggacataacgcacaggacg
aacagcactgggagtaagcagatgtcgcacactttgcggaaggtgaagcatatcacaagc
tgggaggtcgatacgcagttcagctgtgtcgtgcaggagattgccgacttgaattgtgac
gcgaatcggaacgtggaggttgggatccagctggggctgttccacggtggcaagtcgttg
tgtaagccgatgaagacgcagctggtgtcgctgcacaagggtcgggccgcgtggaacgag
acgatcgtgttcgatatcaacgtgaagaatgttcctaggatggcgcggttgtgtttggtg
atttacgaaaacgtgcgaaccgcgaagggaatcggcgtgagggcgaggagaaccaaggac
ggctttatgaatcctattgcgtgggttaatacgatgctttatgactacaagagtcagctg
aaggcgggtgcggttacgttgtacacgtggacgtacgcggaagattcgcagtcggaagat
gtgctgcatccgcttgggacggttgagccgaacccgcgacgggacgagtgttcttcgatg
atcctgtgcttcgaagattacaaacaggagaacaaaataatagtctacccttcggaggat
cagctgatgaagcacgcggcgaagaatcggaactgtaaccggccgttgaatcgagacagt
gcggaggaggtgcgaccgatcaaggaaatcctgatgccgtacatccacaacgaccggttg
aacgacatgcacgagcaggaccgaaacgcgatctgggccaagcggcgcgagtgcaaggat
ctcgagccggacggcctgccctgtctgctgtactgcgtcgagtggaacaaccggaatgag
gtggcggaaataactgctctgttgcaagagtggccaattctgccggtggagcgtgccctc
gaactgctcgattacgcgtacgccgatcagtacgtgcggcggtacgcggtcaactgcctc
cgtaccatccaggacgacgagctgctgctgtatctgcttcagctggtgcaagcgatgaag
cacgagtcgtacctctactcagacctagtcgactttctgctgcagcgggcgctcaacaat
caacacattggacactttttcttctggcatttacggtccgagttccagtttccttccgtg
caggtgcgcttcgggttgatcctggaggcatacttgaagggcagtcaggagcacgtggcg
atcctgctgaagcagatgcagtgcctacggaagttacagcagggctcggaactggtcaag
aagggcaacaaggaaaagggcaagtcgctgctgataggccatctgcaggagcgtgccagt
ggggaggccatgtccgatgtgataagtccactcaatccgagcttccggtgtaaatcggtc
cgcgcggacaagtgcaaagtgatggactcgaagatgcgtccgctgtggatcgtgtaccaa
aactccgacatcaacggggacgatataaatattatttttaagaacggcgacgatttgcgc
caagacatgctcaccctacaaatgcttcggatcatggaccggatatggaagagccacggg
cacgacttccggatgaatccgtacagctgcatcagcaccgatcgtcgattaggtattatc
gaggtggttttaaacgcggaaacgatcgccaacatccagaaagagcgcggcatgttctcg
gccacatcccccttcaagaaaggatcgctgctggcgtggctcaaagagcacaacacgacg
gacgaaatgctcgcgaaggcggtgcaggaattcacgctcagctgtgccggctactgcgtg
gccacgtacgtgctgggcgtcgccgaccggcactcggacaacatcatggtgaagaaaacc
ggccagctgttccacatcgactttggccacatcctcggccactttaaggaaaagtttggc
ttccggcgcgagcgggtgccgttcgtgctgacgcacgactttgtgtacgtgatcaacaag
ggccggacggaccgggaggcgcacgagttccgcgagttccagattctgtgtgaagaggca
tttttgattctcagaaagcacggctgcctaattctgtccctgtttgccatgatgatttcg
actggtttgccggaactgtcctccgagaaggatctcaactatttgcgtgaaactttggtg
ctggacctgcccgaggccgaagcccgcgagcacttcaagtccaagttcagcgaagcgttg
gccaactcgtggaagacctcgctcaactgggcctcgcacaacttctccaagaacaacaag
cagtga

DBGET integrated database retrieval system