KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ005593Help
Entry
CpipJ_CPIJ005593  CDS       T01079                                 

Definition
ras GTP exchange factor, son of sevenless
Orthology
K03099  
son of sevenless
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    CpipJ_CPIJ005593
   04630 Jak-STAT signaling pathway
    CpipJ_CPIJ005593
   04068 FoxO signaling pathway
    CpipJ_CPIJ005593
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    CpipJ_CPIJ005593
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1550 aa AA seqDB search
MFAGGQHVSITDATDYDFEKAENAAKWKGVFVTSLRKVLEQLHPSLQAREDALLYVESLC
LRLLAMLCAKPPPHTVQDVEDRIGRTFPTPIDKWALGEARDIIDKSKKKKPVLPVDRVHT
LLQKEVLQYKIDSSVSLFLVAVLEYISADILKLAGNYVKNIRHIEISREDIEVAMCADKY
LAKRIHHASHERLNRIVFIPRTQVLMDMFYQGDSSSSMAPSPLPPTPRTSLSYEEVVKEL
IHDEKQYQRDLHMIIRVFREELVKIVRDPKELDSIFSNIMDIYEVSVTLLGSLEDVIEMS
QEQTPPCIGSCFEELAEAAEFDVYAKYAKDITSVQAKEALANLLARPEANSLMSAGHGFR
EAVNPLKEDKESFEQVQGLLKPLQCELQSISSLLPKEYFARVNSRARRQSAIEKTRDLQN
SVEHWDKDVGQCCNEFIREDTLAKLSSGKRQTERKVFLFDGLLVLCKTRRQIVPGNNYDY
RLKERFFMRKVEIIDRSDTDELKYAFEISPREPTSVVLIAKNAQHKNDWMADLVMLNTKS
MLERILDSILLDIEKKHPLKLPTPEIYAFAVPDSPSNIVLEEREGTGVPLIKGATLTKLI
ERLTYHIYADPMFVRTFLTTYRSFCSPRELLRLLVERFDIPDPTLVYDSAADKDIGSDLD
KFHKNSQREDWKRYKKEYVQPVQFRVLNVLRHWVDHHFYDFERDSELLDELLRFLETVRG
KSMRKWVDSVLKIVQRKNESEDNHRQITFAFGHSPPAIEHHLPLSSEHEFNLLTLHRSSW
PAIYPDWIEKSILEAENFEERVAMASRAIEVMMVLQDLNNFNGVLSIVSAFQGAAVHRLK
LTLEEISKSYQKVLAECGELNNSHYRKYQEKLQNLDPFKGMSVTEISNYVYEESKRIEPK
NCRQPLKFPRKWPDIPLKSPGIKPSSRRNNSSANSSMTLTGTLPFSKTSLLNNNDTGGEQ
SPPANSSSSSVHDYSIFAPVNIHSSSSTSTSSSQYYQHHHQQQQHHSFYQQHHSITQGYN
SCRKATSSSATSPPSQGYSFSQSVVNLASASDQQMAPEIPRRSDSIILTHAPYNLNNSSL
SESSGNPCGSGGGSGKLVPSPRNPYSSMSALSSSSSGISVSSYFGILSASSSDGNSNNNH
STATSFKLTPMLSQPPKVVSNTQHAEDTPNSILSASGLGGGGGGGGMASSSAATNATSIV
SLSDGPTAPLPPLSSVPPSNNNPTGSGNSSSVSSSASASSSSTVVVSSTAYGAGTQSNLP
PPPPTPSSAASGVGDIPPAISPRTDKPAHPPAPPPLRNNGGGGGTEFCYNMSSSSSSFGL
PNCTSPHATSSSSSSSFRNNSTNPLKNQNCDFTSASAALNRSSCENSPIYPSSPKMYFST
TAAAGTSSGMTDFNYSSSASAVSPSLSTSYNSASSTTADSMILNATTSGTGMSGGGGYGG
SSSGDFGPIPISPHVNVPNAHNIPPPMPPPLPPRVKRKESSGESSQSSQVRQAPDAPRLP
PRDLSPPPLPPRTHIQSHYLFGNVQQQQQLYNSSCAVSDSWNHGHQFPVS
NT seq 4653 nt NT seq  +upstreamnt  +downstreamnt
atgttcgctggcggccaacacgtatcgattacggatgcgacagattacgacttcgagaag
gcggaaaatgcagccaaatggaaaggtgttttcgtaacatcgctgagaaaggtcctagag
cagctgcatccctcgttgcaagcacgcgaggatgcgttgctctacgtcgaaagcttgtgc
ttgcgcctgttggcgatgctgtgcgccaaaccgcccccgcacacggttcaggatgtcgaa
gatcggattggtcgcacctttcccaccccgatcgacaagtgggccctgggcgaggcgcgc
gacattatcgacaaatccaaaaagaagaaaccggtgcttccggttgaccgtgtgcacacc
ctgctgcaaaaggaggtgctgcagtacaagatcgacagttcggtttcgttgttcctggtc
gcggtgctggagtacatttcggcggacattctgaagctggcgggcaactatgtgaagaac
attcgtcacatcgagatatcccgcgaggacatcgaggtcgccatgtgcgctgacaagtac
ctcgcaaaacgaatccaccacgcctcgcacgaacggcttaaccggattgtgttcatcccc
cgcacacaggtactcatggacatgttctaccaaggggacagctcgagctcgatggccccg
agtccgctgccgcccacgcctcgtaccagtctcagctacgaggaggtcgtcaaggagctc
atccacgacgagaagcagtaccagcgcgatctgcacatgatcatccgggtgttccgcgag
gagctggtcaagatcgtccgagatcccaaggaactggactcgattttctccaacataatg
gatatctacgaggtatccgtgacgctgctcggttcgctcgaggatgtcatcgaaatgtcg
caagagcaaactcctccctgcatcggtagctgtttcgaagaactagcggaagcggccgaa
tttgacgtgtacgcaaagtacgcgaaagatatcacatcggttcaggcgaaggaagcctta
gcaaatttattggcgaggccggaggcgaattcgctcatgtcggccggtcacggtttcagg
gaagcggttaatcccttgaaggaggacaaagagagcttcgagcaagtgcagggtttgctg
aaaccgctgcagtgcgagctgcaaagtatatcgtcgttgctgcccaaggaatattttgcc
agggtaaacagtcgagcccggaggcagtcggcgatcgaaaagacccgcgatctgcaaaac
agcgtagaacactgggacaaggacgtgggtcagtgctgcaacgagttcatccgggaggat
acgctggcgaagctgagctccggaaagcgccaaaccgaacggaaagtgtttctgttcgac
gggctgctggtgctgtgcaaaacccggcgtcaaatcgtccccggtaacaactacgactac
cgattaaaggaacgtttcttcatgcgcaaggtggaaatcatcgatcggtccgacacggac
gagttgaagtacgcgttcgaaatctcgccacgggaaccgaccagcgtcgtgctgatcgcc
aaaaacgcccaacacaaaaacgactggatggccgatctggtgatgctcaacaccaaatcc
atgctggagcgtattctagacagtattctactagacatcgagaagaaacacccactgaag
ctacctactccggaaatttacgcatttgccgtgcccgattcgccctccaacattgtgctg
gaggagcgcgaaggcaccggagtcccactcatcaaaggcgcaaccctgaccaagctgatc
gagcggctaacctaccacatctacgccgacccgatgtttgtgcgcaccttcctcaccacg
taccggtcgttctgttcgccccgggaactgctgcggctgctcgtggagcgattcgacatt
ccggatccgacgctggtgtacgacagcgccgccgacaaggacatcggctccgacctggac
aagtttcacaaaaactcccaacgggaggactggaagcgctacaagaaggagtacgtccag
ccggttcagttccgggtgctgaacgtgctgcgacactgggtcgaccaccacttttacgac
ttcgagcgggattcggagctgctggacgagctgctgcggttcctggagaccgtgcggggc
aaatccatgcggaagtgggtggactcggtgttgaagattgtgcagagaaagaacgaaagc
gaggacaaccatcggcagataacgttcgcgttcgggcacagcccgccggcgatcgagcac
cacctgccgctgagcagcgagcacgagttcaatctgctgacgctgcaccgctcgagctgg
cccgccatttacccagactggatcgagaagtcgatcctggaggcggagaacttcgaggag
cgtgtggcgatggcatcgcgtgcaatagaggtgatgatggtgctgcaggatttgaacaac
ttcaacggcgtcctgtcgatcgtgtccgcgttccagggtgcggccgtgcaccggctcaag
ctgacgctggaggagatctcgaagagctaccagaaggtgctggccgagtgcggcgagctg
aacaattcgcactaccgaaagtaccaggagaagctgcagaatttagatccttttaaagga
atgagcgttacggagatctcaaactacgtttacgaggagagtaagcgaatagagccgaaa
aattgtcgtcagccgctcaaattcccccgcaaatggcccgacattccgttaaagtccccg
ggcattaagccgtcgtcgcggcgcaacaacagctccgccaactcgtcgatgacgctaacc
ggaacgttaccgttcagcaagacctcgctgctgaacaacaacgacaccggcggggagcag
tcaccgccggccaactcatcgtcgtcttccgtgcacgactactcgatatttgcccccgtc
aatatccactcgtcgtcgtcaacgtccaccagttcatcacagtactaccagcatcaccac
cagcaacagcagcatcattcgttctaccagcagcatcacagcatcacgcagggttacaac
agctgtaggaaggccacttcctcctcggcaacatcgccaccgtcgcagggttacagcttc
tcgcagtcggtggtcaatctggcgtcggcctcggaccagcagatggcgccggagattccc
cgacggtccgacagtattatcctaacccacgcgccgtacaatctgaacaacagcagtctg
tccgagtcgagtggaaatccgtgcggcagcggtggcggaagtggcaagctcgtgcccagt
ccacgcaatccgtactcgtcgatgagtgcgctgtcctcgtcctcgtccggtatcagcgtt
tcctcctactttggcattctgagcgcatcgagcagtgatggtaacagcaacaataatcat
tctaccgctactagctttaaacttacgccaatgcttagtcagccccccaaagtagtaagc
aatacgcagcatgctgaagacactcccaattcgattctttcagcgtctggtctgggaggc
ggaggcggaggcggaggcatggccagcagctcagctgcaacgaacgccaccagtatagtg
tcgctaagcgacggcccaacggcaccgcttccccccttgtcgtccgttccaccttccaac
aacaacccaaccgggtccggcaactcgtcctcagtttcgtcgtcggcctcggccagctcg
tcgtcgaccgtggtggtgtcctcgacggcgtacggtgccggaacgcaatccaatctacca
ccaccaccaccaacgccctcgtccgcggcgtccggcgttggtgacattccacctgcgata
agtccccgtactgacaagccggcacatccgccagcgccgccaccgttgcgcaacaatggc
ggcggcggcggcaccgagttttgctacaacatgtcgtcctcgtcgtcgtcgtttggacta
cccaactgtacatcaccgcatgcaactagtagtagtagtagtagtagctttaggaataat
tcaaccaaccccttaaaaaatcaaaactgtgatttcacctccgcgagtgccgctctgaac
cgctcatcgtgcgagaactcgcccatctacccgtcgagtccgaagatgtacttctcgacg
acggcggcggccggaacttcctccggtatgaccgacttcaactacagcagcagtgccagc
gccgtgtcgccttcgctgtccacgtcgtacaacagcgcatcgtcgacgacggccgactcg
atgatcctgaacgccaccacttcggggacggggatgagcggcggcggcggctatggcggc
agcagcagtggcgactttggtccgattcccatctcaccgcacgtcaacgtaccaaatgca
cacaatattcctcctcctatgccgcctcctctacctcctagggttaaacgaaaagagtcc
tccggagaatcgtcccagtcttcgcaggttcgacaagcgccggacgcgcccaggcttcct
ccgagagatctcagtccacctccgttaccgccacgtacccacatccagtcacactatctg
ttcggtaacgtgcaacagcagcaacagctctacaattccagctgcgcagtcagcgacagc
tggaaccatgggcaccagtttccggtaagttga

DBGET integrated database retrieval system