KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ005726Help
Entry
CpipJ_CPIJ005726  CDS       T01079                                 

Definition
histone acetyltransferase ESA1
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CpipJ_CPIJ005726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 487 aa AA seqDB search
MVAPKMAKLSSEQQPEKDADGGEPAAKQTSKAASSSKEAASASSAAATLSAAEDKLVIGA
EYQVQRQDGSWHTAQLIQSRQNPCDPKHLEYYIHYEGLNRRLDQWVTRDRISSVAVTGTD
KKATTPSAQDYNGKSPVNSLGNSKDPKLGKPSGDVDMGDGDPDRKITRNQKRRHDEINHV
QKTYADMDPTTAALEKEHEAITKVKYIDKLRFGRYEIDTWYFSPYPEEYGKVGTLYVCEY
CLRYMRLPKTLQQHKLTCTHRQPPGNEIYRKGTVSIFEIDGKDHRFYCQTLCLMAKLFLD
HKTLYYDVDPFFFYVLCEIDKEGQHIVGYFSKEKESPEGNNVACILILPPYQRKGYGKLL
IAFSYELSRREGIIGSPEKPLSDLGRLSYRSYWAYTLLELMKEYRTTTIKELSELSGITQ
DDIVYTLQSMKMVKYWKGQHVICVTSKVVLEHLQLPQFKKPKLMIDPAYLKWTPQKRTIP
VKQVKKA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggtagcccccaagatggccaaactaagcagcgagcagcagccggaaaaggacgccgac
ggcggtgagccggcggccaagcaaacgtcaaaagccgcatcatcatcgaaggaggcggcg
tcggcatcgtcagcggcagccacattatcagcagccgaggataagctggtgattggggcg
gagtatcaagttcagcgtcaggatggttcgtggcacacggcgcagctgattcagagccgg
cagaatccgtgcgatccgaagcatttggagtattacatccactatgaggggttgaaccgg
cggttggaccagtgggttacgcgggaccggatttcctcggtcgccgttacgggtacggac
aagaaggccacgacaccgtccgcgcaggactacaatggcaagagtccggttaattcgctg
gggaattccaaggatccaaagttgggtaaacctagtggtgacgtggacatgggcgatggg
gatccggacaggaagattacgcgaaatcagaaacgacggcacgatgaaattaatcacgta
cagaagacgtacgccgacatggatccgacgacggccgcgctggagaaagagcacgaagcc
atcacaaaggtaaagtacatcgataagctgcgatttggccggtatgaaatcgatacttgg
tatttttcgccttacccggaagagtacggtaaagtcggaacgttgtacgtgtgtgagtat
tgtctgaggtacatgcgcctgcccaagacacttcaacagcataagttgacctgcacacat
cgtcaaccgccgggaaatgagatctaccgcaagggaacggtttcgatatttgaaattgac
ggcaaagatcatcgcttttactgtcagacgctctgtctgatggccaaactgttcctggac
cacaaaacgctgtactacgacgttgatccgtttttcttttacgtgctctgcgaaatcgac
aaagagggtcaacacatcgtgggttatttctcaaaggagaaagagtcccccgagggaaac
aacgttgcatgcatcctgattttgccaccgtaccagcgaaagggctacggcaagttgttg
atcgcgttcagttacgagctgtcgagacgcgagggcataatcggaagtcccgaaaagccc
ttgtccgatctgggccggctgagttaccgcagctattgggcctacacgttgctggagctg
atgaaggaatatcgaactaccaccatcaaggaactcagcgaactatccggtattacgcag
gacgacatcgtttacacgctgcaatcgatgaaaatggtcaagtactggaagggacagcat
gtgatttgtgtgacttcgaaggtggttctcgagcatcttcagctgccacagttcaaaaag
cccaaactgatgatcgatccggcttatctcaagtggacaccccagaagcgaaccattccc
gtgaagcaggtcaagaaggcttag

DBGET integrated database retrieval system