KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ005767Help
Entry
CpipJ_CPIJ005767  CDS       T01079                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cqu00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 477 aa AA seqDB search
MTAILGAGISGLSAGYYLLKKGLPSPPVIYEASSRIGGWIRTERFDGEGYVFEAGPRTIR
PKGPAARNTLDLIEEVGLGEHVHPIFSNHVAARNRMIYAKGRLNMLPSDLSGVVKTVPPF
TKPLFFAGLKDLFGGKSRKKLDDEAMYSFVERRFGKEIADYAISSMLCGICAGDAKQISV
KFLMKSLFEVEQKHGGVVKGMLMEALGKKDKNSSKQVPLEGLAKRAKSENWSIYSIQGGL
QTLPNRLKSVLDEGQVDIRTDVKCEEIEFKGNKVELRVDGEERTLDRLISSIPSYKLAKY
LAKQHPILARELAAIPFVDVGVINLRFKNPDLLKQKAFGFLVPPIEKLPILGCIFDSCCF
DMEDNTVLTVMMGGAWFRQWFGENPSEEQLLEVALKQVNQILNINQKPDSYKVNILRRCI
PQYVVGHQKRVDGIKQYIRDHNLPLGLCGASYDGVGVNDVILSARVSVDEVVGTNKN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacggccattcttggcgccggtataagcggtctttccgccggatactaccttctgaag
aaaggccttccctccccacccgtaatctacgaggccagcagccgaattggcggttggatt
cgcacggaacggttcgatggcgaaggatacgtattcgaggccggtccgcgcacaatccgc
ccaaaagggcccgccgcccggaacacgctggacctgatcgaagaggtcgggttgggtgag
cacgtccatccgatcttctcaaatcacgtggccgctaggaaccggatgatctacgccaag
gggcggctcaacatgctgccgtcggatttgtccggggtggtgaagacggtgccccccttt
acgaagccgttgtttttcgctgggcttaaggatttgtttggggggaagtcaaggaagaag
ctggacgacgaagcgatgtacagttttgtggagcgacgtttcgggaaggagattgcggac
tacgcgatcagttcgatgctgtgtggaatctgtgcgggggatgccaagcagattagtgta
aagtttttgatgaagagcttgtttgaggttgagcagaagcatggaggagttgtgaaggga
atgctaatggaagcgttggggaagaaggacaagaatagctcaaagcaggttccgctggaa
gggctggctaaacgggccaagtcggaaaattggagcatttactcgattcagggagggctg
cagacactgccaaacaggttgaaatcggtactcgacgaaggacaggtggacatccgaacc
gatgtcaagtgcgaggagatcgagttcaaagggaacaaagttgagcttcgtgtcgacgga
gaagaacggaccctggaccggttgattagcagcattccaagctataaactagctaaatat
cttgccaagcaacatcccattcttgcccgagaacttgccgcaatcccatttgtagacgtg
ggcgtgatcaatctacgattcaagaatccagacctgctcaagcaaaaggccttcggattt
ctggtgcctccgatcgaaaaactgccaatcctgggttgcatcttcgacagctgctgtttc
gacatggaggacaatacggtgctaaccgtaatgatgggcggggcatggttccggcagtgg
ttcggggaaaaccctagcgaagaacagctgctggaagtggcgctgaaacaggtgaaccag
attttaaacatcaaccaaaagcccgactcgtacaaggtgaacattttgcgccgatgcatt
ccccagtatgtggtgggacaccagaagcgggtggacggaatcaagcagtacattcgggac
cacaatctgccgctgggactgtgtggagcgtcgtacgatggcgttggcgtgaatgatgtg
attctttcggcgagggttagcgttgatgaggtggttggtactaataaaaattga

DBGET integrated database retrieval system