KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ005789Help
Entry
CpipJ_CPIJ005789  CDS       T01079                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cqu00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 598 aa AA seqDB search
MNGGPSRSKFGSLLGVLYVGHTSCKFLIYAAKNAEVLTCHEEKLAAISPQSGWVEFDPVQ
IWQSARDCINSGVQNLLLLDIDPRDIVGLGVCNQRESSVLWDGDSGRPLCNAIGWCDTRT
SGVVSELLTKVKGKTNFLKAVCGLPFANCFSAVKIRWMLDNVEGLEGKELMFGTLDSWII
WNLTGGADGGIHVTDVTNASRTMLMNLASLQWDPRLCNFFRIPASILPRIYSCAEVYGYV
SVGSLAGIPIASCLGDQQAALLGQMCLQAGQLTCNLDEGSYLMFNTAQEIIDSDNGLLST
VAFKLGPNAQTFYALEGAIPHSGSSIGWMYDNLQLPSDPNQNGSLTQSFLGDPGGPSAVL
STICSMNSSFESPTISNFKNPNFEVILVPAFSGYYTPYWRYKARGMLFGLTLQTTAQQIL
FSAYEAVCFQVRELLESLARDCRMWPQVTKLVAGGDLSERPFLMQMLADLCGVSIERPQT
STPACLGTMLAAGLATGILSLEDFKASCVPPIDYYQAALNSSQRDMKFRKWKVAVDRCLN
FESVSETDLSKFQQEALDPDHTVRCSIPGSVYVISSFALVVLAQILQQSGGGVGSLPK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcggtccttcgcgcagtaagtttggctcgctgctcggtgtcctgtacgtgggc
cacacgagctgcaagtttctgatttatgcggcaaagaatgcagaggttctaacgtgccac
gaggagaagctggcggcgatttcgccacagtctggatgggttgagtttgatccggttcag
atctggcagtcggcgagggattgtataaattcgggggtgcagaatctgctgctgctggac
atcgatcctcgggatattgtggggttgggagtatgcaaccaacgggagagtagcgtcctt
tgggatggcgacagtgggcggccgttatgcaacgcgattggttggtgtgacacgaggact
tcgggggtggtcagcgagctgttgaccaaggtgaaggggaagaccaacttcctgaaggcg
gtttgcgggttgccgtttgcgaactgttttagcgccgtcaagattcgctggatgctggac
aacgtggaagggttggaggggaaggaattgatgtttgggacgttggacagctggattatc
tggaatttgaccggtggggctgatggggggattcacgtgactgatgtgacgaacgcctcg
aggacgatgctgatgaacttggcgagtttgcagtgggatccgcggttgtgtaacttcttt
agaattccggcaagtattctgcctcgaatctacagctgtgccgaggtttacgggtacgta
agcgttggatcgctggccgggattccaatcgccagttgccttggtgaccaacaggcggca
ttgctaggacagatgtgccttcaagcgggtcagctgacgtgcaacctcgacgaaggttcc
taccttatgttcaacacggcccaggagatcatagactcggacaacggtctactgtctacc
gttgctttcaagctgggtccaaacgcacaaaccttctacgccctggaaggagcgatccca
cattccggtagctcaatcggttggatgtacgacaacctgcagcttccaagcgatcccaac
cagaacggctctcttacccaaagcttccttggcgaccccggaggcccctcggctgtccta
tcaaccatatgttcaatgaactcctcgttcgaaagtccaacaatcagtaacttcaaaaac
cccaacttcgaggtgatcctagtcccggccttcagcggctactacacgccctactggcgg
tacaaagcccgcggcatgctgttcggactaacgctacagacaacggcccagcagatcctg
ttttccgcgtacgaggccgtgtgcttccaggttcgggaactgctcgaatccctagcccga
gactgccggatgtggccccaggtgacgaagctggtcgccggtggtgatctcagcgagcgc
cccttcctgatgcaaatgctggccgacctttgcggcgtgagcattgagcggccccaaacg
tcgacccctgcatgcttggggacgatgctggcggcgggacttgccacggggatactctcg
ctggaggactttaaggcgagctgcgtgccaccgatcgactactaccaggctgcacttaat
tctagtcaacgagatatgaaattccgcaagtggaaggtggccgttgatcggtgcctcaac
tttgagtccgtctccgagacggacctgtcgaagtttcagcaggaagcgctggatcccgac
cacacggtgcgttgctccatcccggggtcggtctacgtcatctcgtcgtttgcgctggtc
gtgctggcgcagattctccaacagagtggcggcggcgttggttcgctgcccaagtag

DBGET integrated database retrieval system