KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ005897Help
Entry
CpipJ_CPIJ005897  CDS       T01079                                 

Definition
O-mannosyltransferase 1
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    CpipJ_CPIJ005897
Enzymes [BR:cqu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     CpipJ_CPIJ005897
Glycosyltransferases [BR:cqu01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   CpipJ_CPIJ005897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 791 aa AA seqDB search
MEPITEPTSDEAVLRNRKSHKKGKTASLGKESETLCDAEEENSLENGKRLERSGDDEPAN
IKAPIVGGQEKEVEEESRFVIRVQLDGASVLLFLASFVTRFYRLTHPNGVVFDEIHYGRF
ASLYLRNTFYFDQHPPLGKLMVAGAASAVGYNGKFEFPKIGSEYDASVPIFAFRFFPALC
GSLLAPVVYSILRQMKLSQQICIIGGLLIVCDNALLTHSRFILMEPMLLLFSGAGILFIL
KFLNSRPFSTRWWCFGALAAASLTAGVCVKYVGIYSFFLACYIIGRHIWMQLPDRTQSNF
YLAVKVIVKIGLFVAVSMGVYVGCFYVHLNTLHKAGPHDSVMTSAFQASLEGGLASITKG
QPLRIQHGSQITLKHTHGRVCWLHSHAHVYPIKYKDGRGSSHQQQVTCYGFKDVNNWWIV
KRPNKESIVVDDEPDYIEHGDVIQLVHGVTSRALNSHDVASPMTPLSQEVSCYIDYNISM
PANLLWKVEIINAKESNNKWNAIMSQIRLVHVNTTAALKYTGEQLPDWGFNQFEVAADRR
QFTMDTIWNVEEHRYTQDKDKKDVLEKLLKTEMIPTEPTQLSFWDKFYELQMKMLVHAEK
LEGHMYSSEPFEWPLMDKGIAYWVDSASNAQIHLLGNLVIWYSATLAIVAYVGFLVFYLI
RRRRKFFDLNEDEWQKFRFGGEIFLAGYFIHYLPYLFVERTLFLYNYLPALLYKILLLCF
VLEHIQLAIRKFVKLRLVSIIFSAILTNWMVGVFYYFSKYSVLSYGTTELSADDVLNLRL
KDTWDLIVHKP
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaatcacggaacccacatcggacgaggcagttttacgcaatcgaaagtcacac
aagaaaggcaaaactgcatctttggggaaggagagcgagactttgtgcgacgcggaagag
gaaaattcgctggaaaatggcaagagacttgagcggtccggcgacgacgaacccgcaaac
atcaaggctccgatcgtgggcggacaggaaaaggaagtggaggaagagtctcgatttgtg
attcgggtacagctggacggagcttccgtgctgctgtttctggcctcgttcgtgacccgg
ttttaccgactgacccatcccaatggagttgtgttcgacgaaatccactacggtcggttc
gcatcgttgtacctccggaacaccttctactttgaccagcatcctccgctgggtaaactc
atggtggccggagcggccagtgccgttggctacaacggcaagttcgagttccccaagatt
ggcagcgaatacgacgcgagcgtgcccatctttgcattccgattcttccccgcactgtgt
ggaagtttgctagcccccgttgtctacagcatcctgcgccagatgaaactcagccaacag
atttgcataatcggaggactgctgattgtttgtgacaacgccctcctaacccactcgcgg
tttatcctgatggagccgatgctgctgctgttctccggcgccggaatcctgttcatcctc
aagttcctcaacagtcgaccgttctcgacccggtggtggtgcttcggagcgttggccgcg
gcctcactgaccgccggagtgtgtgtaaaatacgttggcatctacagcttcttcctggcg
tgctacatcattggccgtcacatctggatgcagctgccggatcgtacgcagtccaacttt
tatctagcggtgaaggtgatcgtgaagatcggattgtttgttgcggtatcaatgggcgtg
tacgttggctgcttctacgtacatctgaacactctacataaggcgggtccgcacgacagt
gtgatgaccagtgccttccaggcgtcgttggaaggtggtcttgcgtcgatcaccaaggga
cagccgcttaggattcagcacggatcgcagattacgctgaagcacacacacggtcgagtt
tgctggcttcactcgcatgctcacgtttacccgatcaagtacaaggacggacgaggatcc
agccatcaacagcaggtcacctgttacgggttcaaggacgtgaacaactggtggatcgtg
aagcgaccgaacaaggagagcatcgtggtggatgatgaaccagactacattgaacacggc
gatgtgattcaactagtgcatggagttaccagtcgtgcactgaacagtcatgacgtcgca
tcgccgatgaccccactgagtcaggaggtttcatgctacattgattacaacatctccatg
ccagcgaatctgctgtggaaggtggagatcatcaacgcgaaggagtccaacaacaagtgg
aacgccattatgtcgcagattcgtttggtacatgtcaacaccaccgctgccctgaagtac
accggcgagcagcttcccgactggggtttcaaccagttcgaagttgccgccgatcggaga
cagttcaccatggacacgatctggaacgtcgaagagcaccgctacacacaggacaaggac
aagaaggacgttctggagaagctgctgaaaacggaaatgattccgaccgaaccgacgcag
ctttccttctgggacaagttctacgagctgcagatgaagatgttggtgcacgcggaaaag
ctcgaaggtcacatgtactcgtcggaacctttcgagtggcctctcatggacaagggcatt
gcgtactgggtggacagtgcatccaacgcgcagattcatctcctcggaaacctcgtcatc
tggtactctgcaaccctagcgatcgttgcctacgtcggattcctcgtgttctaccttatc
agacgccggcgaaaattcttcgacctcaacgaagatgaatggcaaaagttccgcttcggg
ggcgagatcttccttgctggatactttatacactacctgccgtaccttttcgtggagcga
acgctcttcctgtacaactatctgccggctttgctgtacaaaatcctgctgctctgcttc
gtgctcgaacacatccagctggcgatcaggaagtttgtgaagcttcgactggtttcgatc
attttcagcgcgatactgaccaactggatggtcggcgtattctactacttctcaaagtac
agtgttcttagctacggaaccaccgaactaagtgcagatgacgtcctgaatctgcgactg
aaagacacctgggatttgatcgttcataagccttga

DBGET integrated database retrieval system