KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ005933Help
Entry
CpipJ_CPIJ005933  CDS       T01079                                 

Definition
hypothetical protein
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:cqu03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:cqu03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 171 aa AA seqDB search
ESAPVKANAAANRGKNNSNSNSKRSAAPTSGGAGNKSDRSAPAAPDGSAGSARKNSDRHV
LKKRVLPKYYTRENDIYVTYKSDFVLQFKRCLEILNSSIGEVFLHCTGRAINRGINLALK
VKAEYPDAFDYEVNTSTITVTDDLHPLKDDDDFGEQRRMNSCLHVRLYRTV
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
gaaagtgcccctgttaaggccaacgcagcagcgaaccgcggtaagaacaacagtaacagc
aactctaaaagatcggcggcgcccacttccggtggtgctggcaacaaatcggatcgtagt
gctccggcagcaccggatggttctgccggatctgcacgcaagaacagtgatcggcacgtg
ctgaagaaacgggttctgccaaagtattacacgcgggagaacgacatctacgtgacgtac
aagtcggactttgtgttgcagtttaagcgctgtctagagatattgaactcgtccatcgga
gaggtgttcctgcactgcacgggtcgcgccatcaaccgcggcatcaatcttgccctcaaa
gttaaggcagaatatccggacgcgtttgattacgaggtcaacacttccacgataaccgta
actgacgatctccacccgctgaaggacgacgatgatttcggcgagcagcgccgaatgaac
tcctgtctgcacgtccgtctgtatcgtaccgtttag

DBGET integrated database retrieval system