KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ005933Help
Entry
CpipJ_CPIJ005933  CDS       T01079                                 

Definition
(RefSeq) hypothetical protein
  KO
K14527  ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03008  Ribosome biogenesis in eukaryotes
cqu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CpipJ_CPIJ005933
   03008 Ribosome biogenesis in eukaryotes
    CpipJ_CPIJ005933
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     CpipJ_CPIJ005933
Ribosome biogenesis [BR:cqu03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     CpipJ_CPIJ005933
Transfer RNA biogenesis [BR:cqu03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    CpipJ_CPIJ005933
Mitochondrial biogenesis [BR:cqu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    CpipJ_CPIJ005933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alba Rpp20
Motif
Other DBs
NCBI-GeneID: 6037472
NCBI-ProteinID: XP_001847381
VectorBase: CPIJ005933
UniProt: B0WF97
AA seq 171 aa AA seqDB search
ESAPVKANAAANRGKNNSNSNSKRSAAPTSGGAGNKSDRSAPAAPDGSAGSARKNSDRHV
LKKRVLPKYYTRENDIYVTYKSDFVLQFKRCLEILNSSIGEVFLHCTGRAINRGINLALK
VKAEYPDAFDYEVNTSTITVTDDLHPLKDDDDFGEQRRMNSCLHVRLYRTV
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
gaaagtgcccctgttaaggccaacgcagcagcgaaccgcggtaagaacaacagtaacagc
aactctaaaagatcggcggcgcccacttccggtggtgctggcaacaaatcggatcgtagt
gctccggcagcaccggatggttctgccggatctgcacgcaagaacagtgatcggcacgtg
ctgaagaaacgggttctgccaaagtattacacgcgggagaacgacatctacgtgacgtac
aagtcggactttgtgttgcagtttaagcgctgtctagagatattgaactcgtccatcgga
gaggtgttcctgcactgcacgggtcgcgccatcaaccgcggcatcaatcttgccctcaaa
gttaaggcagaatatccggacgcgtttgattacgaggtcaacacttccacgataaccgta
actgacgatctccacccgctgaaggacgacgatgatttcggcgagcagcgccgaatgaac
tcctgtctgcacgtccgtctgtatcgtaccgtttag

DBGET integrated database retrieval system