KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006003Help
Entry
CpipJ_CPIJ006003  CDS       T01079                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cqu00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 328 aa AA seqDB search
MSLTKLHSSIFHPTLRKLQCQDVDIAAHNLMYPIFLVEDDDAIQEIPSMPGVARYGINPL
KKHLTPLVEKGLASILLFGVVEKLPKDPTGTGADSKDNPVVKALPLLRKWFPDLLIACDV
CLCPYTSHGHCGVLTEDGVIDNEPSIQRIAEISLAYARAGAQIVAPSDMMDNRIWAIKKI
LRENKLENRVSVLSYSVKFASGFYGPFRDAAKSAPAFGDRKCYQLPPGSKGIARRAAKRD
VEEGADMLMVKPGMAYLDIVKQVKDDYPELPLFIYQVSGEYSMLLNAGKIGAFDLRTVLW
EVLVGMRRAGADCIITYFTPTLLDWLRE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgacgaagctccacagcagcatcttccacccgacgttgcgcaagctccagtgc
caggacgtggacattgcggcgcacaatttgatgtatccgatctttctggtggaagatgac
gatgcgattcaggagattcccagcatgcccggagtggcccggtacgggatcaacccactt
aagaagcatttgacgccgttggtcgagaagggactggcgtcgattttgctgttcggagta
gtggaaaagttgccgaaggaccccaccggcaccggcgccgactcaaaggacaaccccgtg
gtcaaagcgctgccgctgctccgcaaatggttccccgatctgctgattgcctgcgacgtg
tgcctctgtccgtacaccagccacggtcactgcggtgtcctcacggaggacggcgtcatc
gacaacgaacccagcatccagcggatcgcggaaatctcgctggcctatgcccgggctggg
gcgcagattgtggccccgtcggacatgatggacaaccggatttgggcgatcaagaagatt
ttgcgggagaataagctggagaatcgcgtttcggtgctgtcgtactcggtcaagtttgcg
tccggattttacggaccgttccgggatgcggccaaatcggcaccggcctttggggatcgc
aagtgctaccagctgccgccgggatcgaagggaattgcacgacgagctgcgaaacgtgac
gtcgaagaaggcgccgatatgctgatggtcaagcccggcatggcctacttggacatcgtc
aagcaggtgaaggacgactatccggagcttccgctgttcatctaccaggtgtccggcgag
tactcgatgctgctgaacgccggcaagatcggcgcgttcgacctgcggacggtgctgtgg
gaggttctggtgggaatgcgccgggccggggcggattgcatcatcacgtactttacgccc
acgctgctcgactggctgcgggagtag

DBGET integrated database retrieval system