KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006003Help
Entry
CpipJ_CPIJ006003  CDS       T01079                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CpipJ_CPIJ006003
Enzymes [BR:cqu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CpipJ_CPIJ006003
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CpipJ_CPIJ006003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 328 aa AA seqDB search
MSLTKLHSSIFHPTLRKLQCQDVDIAAHNLMYPIFLVEDDDAIQEIPSMPGVARYGINPL
KKHLTPLVEKGLASILLFGVVEKLPKDPTGTGADSKDNPVVKALPLLRKWFPDLLIACDV
CLCPYTSHGHCGVLTEDGVIDNEPSIQRIAEISLAYARAGAQIVAPSDMMDNRIWAIKKI
LRENKLENRVSVLSYSVKFASGFYGPFRDAAKSAPAFGDRKCYQLPPGSKGIARRAAKRD
VEEGADMLMVKPGMAYLDIVKQVKDDYPELPLFIYQVSGEYSMLLNAGKIGAFDLRTVLW
EVLVGMRRAGADCIITYFTPTLLDWLRE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgacgaagctccacagcagcatcttccacccgacgttgcgcaagctccagtgc
caggacgtggacattgcggcgcacaatttgatgtatccgatctttctggtggaagatgac
gatgcgattcaggagattcccagcatgcccggagtggcccggtacgggatcaacccactt
aagaagcatttgacgccgttggtcgagaagggactggcgtcgattttgctgttcggagta
gtggaaaagttgccgaaggaccccaccggcaccggcgccgactcaaaggacaaccccgtg
gtcaaagcgctgccgctgctccgcaaatggttccccgatctgctgattgcctgcgacgtg
tgcctctgtccgtacaccagccacggtcactgcggtgtcctcacggaggacggcgtcatc
gacaacgaacccagcatccagcggatcgcggaaatctcgctggcctatgcccgggctggg
gcgcagattgtggccccgtcggacatgatggacaaccggatttgggcgatcaagaagatt
ttgcgggagaataagctggagaatcgcgtttcggtgctgtcgtactcggtcaagtttgcg
tccggattttacggaccgttccgggatgcggccaaatcggcaccggcctttggggatcgc
aagtgctaccagctgccgccgggatcgaagggaattgcacgacgagctgcgaaacgtgac
gtcgaagaaggcgccgatatgctgatggtcaagcccggcatggcctacttggacatcgtc
aagcaggtgaaggacgactatccggagcttccgctgttcatctaccaggtgtccggcgag
tactcgatgctgctgaacgccggcaagatcggcgcgttcgacctgcggacggtgctgtgg
gaggttctggtgggaatgcgccgggccggggcggattgcatcatcacgtactttacgccc
acgctgctcgactggctgcgggagtag

DBGET integrated database retrieval system