KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006029Help
Entry
CpipJ_CPIJ006029  CDS       T01079                                 

Definition
(RefSeq) hypothetical protein
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     CpipJ_CPIJ006029
Peptidases [BR:cqu01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   CpipJ_CPIJ006029
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   CpipJ_CPIJ006029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
VectorBase: 
UniProt: 
AA seq 405 aa AA seqDB search
MKMNRAEQQEGDWIGEICLATCKICILVFVIIFIVLPLIFKFSFALQKGILFLTFITYPP
NLDLKRPEKSGLYATRNFYITYRDQEEDIDVDIAVWHVLPNDLVRRFGRELQMDEATLAN
VTAPEEMRSELDKVSNKDASKYHEIEKILARDGLNLEDDDTRRELFEASLKATTNDIVLY
LHGNSASRGASHRVDLYKLLRSLNYHVITLDYRGYGDSANLSPTERGVVYDSLAVYQYIT
SVSKNPVYLWGHSLGTGVATHLLSLLTDMSMPGPRALVLESPFNNIREEICAHPFSKLYR
HLPWFDYTISKPMYANELRFESDQHIAEFRQPVLILHAEDDHVVPFHLGYKLYRTALDTR
GKSWGPVEFHRFERTSHYGHRYICRAPNLPEIVIRFFRTYRDEQY
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaaccgcgccgaacagcaggagggggattggatcggcgaaatatgcctggcg
acgtgcaagatctgcatcctggtgtttgtgatcatcttcatcgtgctgccgttgatcttc
aaattttcctttgccctgcagaaaggcattctgtttctcacgttcataacctacccgccg
aacctggacctgaagcggccggagaagagcggtctgtacgcgacgcggaacttttacatc
acctaccgcgaccaggaggaggacatcgatgtcgacattgccgtgtggcacgtgctgccc
aacgatctggtgcggcggtttggccgcgagctgcaaatggatgaggcaaccctggccaac
gtgaccgctccggaggagatgcgatccgaactggataaagtgtccaacaaggacgcgtca
aagtatcatgaaatcgaaaagattctcgcccgggacggactcaacctggaggacgacgac
acccgacgggagttgttcgaggccagcctgaaggcgaccacgaatgatattgtgctgtac
ctgcacgggaatagcgcctcccgaggggcgtcccatcgcgttgatttgtacaaactgttg
cgcagcttgaactaccacgtgattacgctggactaccgcgggtacggagattcggcgaat
ctatcgccgacggaacgtggcgtagtttacgattcgttggccgtgtatcagtacatcaca
agtgtaagcaagaatccggtgtatttgtggggtcactcgctgggaacgggcgtcgcgacg
cacctgttgtcgctgctgacggacatgagcatgccgggaccgagggcgctcgtgctggag
agtccgtttaataatataagggaggagatttgcgcgcatccgttttcaaagttataccgt
cacctgccctggttcgactacacgatctcgaagccgatgtacgccaacgagctgcggttc
gagtcggaccagcacattgccgagttccggcagccggtgctgattctgcacgccgaggac
gaccacgtggtgccgttccatctcggatataagctttatcgcaccgcgctcgatacccgc
ggcaagtcgtggggcccggtcgagttccaccggttcgagcgcaccagccactacggccac
cggtacatttgccgtgcgccgaacctgccggagattgtgatccggttcttccgcacgtac
cgcgacgagcagtactag

DBGET integrated database retrieval system