KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006034Help
Entry
CpipJ_CPIJ006034  CDS       T01079                                 

Definition
acetylcholinesterase
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CpipJ_CPIJ006034
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     CpipJ_CPIJ006034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 688 aa AA seqDB search
MEIRGLITRLLGPCHLRHLILCSLGLYSILVQSVHCRHHDIGSSVAHQLGSKYSQSSSLS
SSSQSSSSLAEEATLNKDSDAFFTPYIGHGDSVRIVDAELGTLEREHIHSTTTRRRGLTR
RESSSDATDSDPLVITTDKGKIRGTTLEAPSGKKVDAWMGIPYAQPPLGPLRFRHPRPAE
RWTDRGHVFGDFPGATMWNRNTPLSEDCLYINVFVPRPRPKNAAVMLWIFGGGFYSGTAT
LDVYDHRTLASEENVIVVSLQYRVASLGFLFLGTPEAPGNAGLFDQNLALRWVRDNIHRF
GGDPSRVTLFGESAGAVSVSLHLLSALSRDLFQRAILQSGSPTAPWALVSREEATLRALR
LAEAVNCPHDATKLSDAVECLRTKDPNELVDNEWGTLGICEFPFVPVVDGAFLDETPQRS
LASGRFKKTDILTGSNTEEGYYFIIYYLTELLRKEEGVTVTREEFLQAVRELNPYVNGAA
RQAIVFEYTDWIEPDNPNSNRDALDKMVGDYHFTCNVNEFAQRYAEEGNNVFMYLYTHRS
KGNPWPRWTGVMHGDEINYVFGEPLNSALGYQDDEKDFSRKIMRYWSNFAKTGNPNPSTP
SVDLPEWPKHTAHGRHYLELGLNTTFVGRGPRLRQCAFWKKYLPQLVAATSNLQVTPAPS
VPCESSSTSYRSTLLLIVTLLLVTRFKI
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggagatccgaggcctaataacccgattactgggtccatgtcacctgcgacatctgata
ctgtgcagtttggggctgtactccatcctcgtgcagtcggtccattgccggcatcatgac
atcggtagttcggtggcacaccagctaggatcgaaatactcacaatcatcctcgttatcg
tcatcctcgcaatcgtcatcgtcgttagctgaagaggccacgctgaataaagattcagat
gcattttttacaccatatataggtcacggagattctgttcgaattgtagatgccgaatta
ggtacattagagcgcgagcatatccatagcactacgacccggcggcgtggcctaacccgg
agggagtccagctccgatgccaccgactcggacccactggtcataacgacggacaagggc
aaaatccgtggaacgacactggaagcgcctagtggaaagaaggtggacgcatggatgggc
attccgtacgcgcagcctccgctgggtccgctccggtttcgacatccgcgacccgccgaa
agatggaccgatcgtggacacgtgttcggtgacttcccgggggccaccatgtggaaccgg
aacacaccgctctcggaggactgtctgtacatcaacgtgttcgtgccacggcccaggccc
aagaatgccgccgtcatgctgtggatcttcgggggtggcttctactccggaactgccacg
ctggacgtgtacgaccaccggacgctggcctcggaggagaacgtgatcgtagtttcgctg
cagtaccgtgtcgcaagtcttggttttctcttcctgggcacaccggaggcacccggtaac
gcggggctgtttgatcagaacctggcactgagatgggtccgcgacaacatccaccggttc
ggcggtgacccctcgcgggtcacgctgttcggcgagagcgccggagcggtctcggtttcg
ctgcacctgctgtcggcgctctcgcgggacctgttccagcgggccatcctccagagtggc
tccccgacggccccgtgggcgctggtttcgcgcgaagaagctacgcttagagctcttcgt
ctggccgaggccgtcaactgtccgcacgatgcgaccaagctgagcgatgccgtcgaatgt
ctgcgaaccaaggacccgaacgagctggtcgacaacgagtggggcacgctggggatctgc
gagtttccgttcgttccggttgtggacggagccttcctcgatgagacaccgcagcgttcg
ttggccagcgggcgcttcaagaaaacggacatcctgaccggcagcaacaccgaggagggt
tactactttatcatttactatctaaccgaactgctcaggaaagaggaaggggtcacggta
acacgcgaggagttcctacaggccgtccgggagttgaatccgtacgtgaacggtgccgcc
cggcaggccatcgtgttcgagtacacggactggatcgaaccggacaacccgaacagcaac
cgtgacgcgctggacaagatggtcggggattatcacttcacctgcaacgtgaacgaattc
gcccagcggtacgccgaggagggcaacaacgtgttcatgtacctgtacacgcacagaagc
aaaggaaacccctggccgaggtggaccggcgtgatgcacggcgacgagatcaactacgtg
tttggcgaaccgctgaactcggccctcggctaccaggacgacgagaaagactttagccgg
aaaattatgcgatactggtccaactttgccaagactggcaatcccaacccgagtacgccg
agcgtggacctgcccgaatggcccaagcacaccgcccacggacgacactatctggagctg
ggactgaacacgaccttcgtgggacggggtccacgattgcggcagtgcgctttctggaag
aaatatttgccgcaactagtagcagctacctctaacctccaagtaactcccgcgcctagc
gtaccttgcgaaagcagctcaacatcttatcgatccactctacttctaatagtcacacta
cttttagtaacgcggttcaagatttaa

DBGET integrated database retrieval system