KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006048Help
Entry
CpipJ_CPIJ006048  CDS       T01079                                 

Definition
phospholipid hydroperoxide glutathione peroxidase 1
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cqu00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cqu00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 286 aa AA seqDB search
MSNKQGYDISQDIVAPNSIRESPLLDTACIKLDIRVSLVSLFTKLALNPNDLMLDECFLL
PNQVRIPQLQFVASRTMFALPLLPYISLPVICETFKFRLQIPIYCGYRYKYTGSEMAEES
TSDYKKASSVYDFTVKDGQGNDISLEKYRGKVLLIVNIASQCGLTKGNYAELTELSKKYE
DKEFKILSFPCNQFGSQMPEKDGEEMVCHLRSAKAEVGDVFARVNVNGDEADPLYKYLKH
KQGGSLGSFIKWNFTKFLVDKAGQPVGRFAPTTNPLDIVKDIDKLL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacaagcagggctacgacatcagccaggacatcgtcgcacccaacagtatccgc
gaatctccgcttctggatactgcctgtattaagctggacatccgagtttcgctagtcagt
ctgttcacgaaactcgccctcaatcccaacgatcttatgctggacgagtgcttcctcctc
ccgaaccaggtgcggatcccccagttgcagtttgtcgcctcgcggaccatgttcgcttta
ccgctgcttccgtacatcagcctgccggtgatttgcgaaacgttcaagttccgtctgcag
attccgatctactgcggctatcgatacaagtacacgggctcagaaatggcagaggaatct
acttcggactacaagaaggcatcgtcggtgtacgatttcacggtaaaggatggccaggga
aacgacatcagcttggagaagtaccgcggcaaggtgctgctgatcgttaacattgcgtcg
cagtgtggtctcaccaagggaaactatgccgagctgacggaattgtccaagaagtacgag
gataaagaattcaaaatcttatcgttcccgtgcaatcagtttggttctcaaatgcccgag
aaggatggagaagaaatggtgtgtcatttgaggagcgcaaaagctgaggttggagacgtg
ttcgcgagggtcaacgtcaacggcgacgaagccgacccgctgtacaagtacctgaagcac
aagcagggtggcagcttgggcagcttcatcaagtggaacttcaccaagttcctagtcgac
aaggctggtcagccagtgggccgttttgcgccgaccaccaacccgctggacattgtgaag
gatattgacaagctgctgtag

DBGET integrated database retrieval system