KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006068Help
Entry
CpipJ_CPIJ006068  CDS       T01079                                 

Definition
utp-glucose-1-phosphate uridylyltransferase 2
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CpipJ_CPIJ006068
   00052 Galactose metabolism
    CpipJ_CPIJ006068
   00500 Starch and sucrose metabolism
    CpipJ_CPIJ006068
   00520 Amino sugar and nucleotide sugar metabolism
    CpipJ_CPIJ006068
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CpipJ_CPIJ006068
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 513 aa AA seqDB search
MTGAIDILLKVRGHQRVPSDTKEFHEATKRDALIRLRKDLDNLLHSADDDKKATVQKEMC
GFEALFHRFLQEDGPSVEWDKIEKLPQDAVKDYSSLKTPQESEIRAMLDKLVVVKLNGGL
GTSMGCHGPKSVIPVRNDLTFLDLTVQQIEHLNKKYSANVPLVLMNSFNTDEDTEKVIRK
YKGFQVQIYTFNQSCYPRISRDSLLPVAKDFNIEADIEAWYPPGHGDFYQSFQNSGLLKK
FIDEGRDYCFLSNIDNLGATVDINILNRLLGSDRQGDKPIEFVMEVTDKTRADVKGGTLI
QYEHKLRLLEIAQVPKEHVDDFKSVKTFKFFNTNNIWARLESIERVLNARTMNMEIIVNN
KTLDNGMRVIQLETAVGAAMKCFDDGIGINVPRSRFLPVKKTSDLLLVMSNLYSLKYGSL
VMSPQRMFPTTPLVKLGDNHFSKVKEFLGRFANIPDLIELDHLTVSGDVTFGRGVSLRGT
VIIIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgacgggggcgatcgacatactgttgaaagttcgcggccaccagcgtgtcccgtccgac
acgaaggagttccacgaggccaccaagcgtgatgcgttgatccgtttgcgcaaagatttg
gacaatctgctgcactcggccgacgatgacaaaaaggcgaccgtccagaaggaaatgtgc
ggcttcgaggccctgttccatcgcttcctgcaggaggacggcccgtcggtcgagtgggac
aaaatcgagaagctgccccaggatgccgtcaaggattactccagcctgaagacgccccag
gagtcggagattcgtgccatgctggacaaactggtcgtggtcaagctgaacggtggtctc
ggaacgtcgatgggttgccacggaccaaagtccgtcattccggtgcgtaacgaccttaca
ttcctggatttgaccgtgcagcagattgagcacctgaacaaaaagtacagcgccaacgtg
ccgctcgtgctgatgaactcgttcaacaccgacgaggacaccgaaaaggtcatccgcaag
tacaagggattccaggtccagatttatacctttaaccagagctgctacccgcgcatcagc
cgagactcgctgctgccggtggcgaaggatttcaacatcgaagctgacattgaggcatgg
taccctcccggtcacggtgatttctaccagtcgttccagaactcgggtctgctgaagaag
ttcatcgacgaaggccgcgactattgcttcctgtctaacattgataacttaggcgcaacg
gttgacatcaacattttgaaccgattgctcggcagcgatcgccagggtgacaagccgatc
gagtttgtgatggaagtgaccgacaagactcgggctgacgttaagggtggtaccttgatc
cagtacgagcacaagctgcgactgctggaaatcgctcaggtcccgaaagagcacgtcgat
gacttcaagtcggtgaagacgttcaagttcttcaacaccaacaatatttgggcccgtttg
gagtcgatcgaacgtgtcctgaatgcgcgcacaatgaacatggagatcatcgtcaacaac
aaaacgctggacaatggcatgcgcgtgattcagctggagacggccgtcggtgcggcgatg
aagtgcttcgacgatggaatcggaatcaacgttccgcggtcacgcttcttgccggtcaag
aaaacgtccgatctgctgctggtcatgtccaacctgtacagtctcaagtacgggtcgctt
gtcatgtcgccgcagcgcatgttccccacgacgcccctggtcaagctgggagacaatcac
ttcagcaaggtcaaggagttcctgggacgcttcgcaaatattcccgacctgatcgagctg
gaccatttgaccgtttcgggagatgtcacgttcggccgtggagtgtcgttgcgtggaacg
gtcattatcattgccaaccatggtgatcggatcgatattcctgcgggagccatcctggag
aataagatcgtatccggtaatatgcgcattctggatcactaa

DBGET integrated database retrieval system