KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006118Help
Entry
CpipJ_CPIJ006118  CDS       T01079                                 

Definition
myst histone acetyl transferase
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CpipJ_CPIJ006118
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 747 aa AA seqDB search
MPPRKKSTSSTESSSGSSSDSSSSDSSSSGSDSGSSSSESDSSSSQETTTARTSNTNSSA
NTPKANEKVVRRRSSEVANNASGAASKTSVSSGTVKEVDKASATAKVIAQKQQKLSKSSV
SSSDEDSSPESKPVVQKKVQQAEAAKKKAQEKQPAQQAPVAPPITGGKVPPSVIKQQQQA
HHHQQQSQPKSAPITKGAAKSAGVGAKEPPKITPPIAKKGGGPNPAASSAPSTKAKKKSI
FSPVNSSESEDEKEKQPQKDRRPSAGGATASKSGKESTAATGKETSMESAASQQQQNQQR
GRGRPRKTPATGGSTGSSSTSTSTTTTTTTTSTTGPVTKPVALVKPHVVSSTPATGSKSS
STTSSTQRQTSSQSAQKPPEEDISSATSTSTDSSSGSGSSDSDSDSSEDSTPSNSANTAA
TSAAAQELKKSNANMKRPLERTPQKGSGDGKDGGGSDSEGEGTKQTRKLTRSSSTRKSKH
LLGKNASETESDGDSPRPMSERDENEIDLEPKLEGIVPDYDLQLFREAQAAASECMENEL
RELVTGKGTRFISMGRHIMQVWYQSPYPDDVARLPKLYLCEFCLRYQKSEVGMKRHAAKC
VWRHPPGDEIYRKGKLGVWQVDGKRHKQYCQHLCLLAKFFLDHKTLYYDVEPFLFYVMTL
ADSDGCHTVGYFSKKRPRRRTPSKLRLRTRKSHHQGSIFPGKSFHQEVTSLISWFRAELL
HCFSNFVGMLAGWLLSLTSSGWLAGVG
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaagaaaaaagtcaacgagcagcacggaatcgagcagcggaagctcttcggat
tccagttccagcgatagcagctcgagcggaagcgattctggaagttctagcagtgagagc
gactcgtccagctcgcaggaaacgactacggcaagaactagcaacaccaactcaagcgcc
aatactcccaaagccaacgagaaggtcgttcgccgtcgcagctcggaagtggccaacaat
gcatccggagccgcatccaaaacatcagtctcatccggaaccgtcaaggaggtggacaag
gccagcgcaaccgccaaagtgatcgcccaaaagcagcagaaactatcgaaaagttccgtt
tcctccagcgatgaagattcctcgccggaaagcaaaccggttgtccagaagaaggttcag
caagcggaagccgccaaaaagaaggcccaggaaaagcaacctgcccaacaagcaccggtc
gctcccccaataaccggcggaaaggtccctccctccgtgatcaaacagcaacagcaagct
caccatcaccagcagcaatctcaaccgaaatccgcccctattacgaagggagcggccaaa
tccgccggcgttggcgccaaagaaccgcccaaaattacccctccgatagcgaaaaagggt
ggcggtcccaatccagcggcctcttcagcaccgtcaacaaaggcgaagaaaaagagcatc
ttttcgccggtcaattcgtccgagtcggaagatgaaaaggaaaaacaaccgcagaaggac
cggaggccgtcggctggaggagccacggcaagcaaatctggcaaggaatctaccgctgcg
actgggaaggagacgagcatggaaagtgccgcaagtcagcagcaacagaatcaacagagg
ggtcgtggtcgccctcgcaaaacccctgctactggtggcagtaccggaagcagcagcact
agcaccagcacaactaccaccaccacgactacgagcacaaccggtccggttaccaaacca
gtagccctggtcaaaccgcacgtggtgtcatccacccctgcaactggttccaaatcaagc
tctacaacctcatcaacccaacgccaaacttcctctcaatcggcacaaaaaccgccagaa
gaggacatttcctccgccacctccacttcaacggattcttcctccggatccggctcttcg
gacagtgattccgactcgtcggaggactcgactccatcgaactcggccaacacggccgcg
acgtccgcagccgcgcaagagctcaagaagagcaacgccaacatgaagcgtccgctggaa
aggaccccgcagaaagggagcggagacgggaaggacggtggcggaagtgacagtgagggc
gaggggacgaagcagacgcgcaagttgacgaggtcgtcgagtacgcgcaagtcgaagcat
ctgctggggaagaatgcttcggagacggaatcggacggagacagtccccgacccatgtcc
gagcgggacgagaatgaaatcgacttggaacccaagctggagggaatcgtccccgactac
gatctgcagctgttccgggaggcgcaagccgccgccagcgagtgcatggagaacgaactg
cgcgagttggtcacggggaagggaacgcggttcatctcgatgggacggcacatcatgcag
gtctggtaccagagtccgtacccggacgatgtggcccggctaccgaagctgtacctgtgc
gagttttgtttgcggtaccaaaagtccgaggtcggcatgaagcggcacgcggccaagtgc
gtgtggcggcatccgccgggcgatgagatctaccggaagggtaagctaggtgtgtggcag
gttgacggtaagcggcacaagcagtactgtcagcatctgtgcctgctggctaagttcttc
ctagaccacaagacgctgtactacgacgtggagccgtttctgttttacgtgatgacgctg
gcggacagcgacgggtgccacacggtggggtacttcagcaagaaacgcccgagacgacga
accccgtccaagctccggctgcgaacgcggaagtctcaccaccaaggctcgattttcccg
ggcaaaagctttcaccaggaagtaacgagcctgatttcctggttccgggcagagctcctc
cactgcttctccaactttgtcgggatgctggctggctggcttttgtcattgacctcgtct
ggctggctggctggcgttggttga

DBGET integrated database retrieval system