KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006121Help
Entry
CpipJ_CPIJ006121  CDS       T01079                                 

Definition
c-GMP dependent protein kinase
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     CpipJ_CPIJ006121
Protein kinases [BR:cqu01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   CpipJ_CPIJ006121
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 844 aa AA seqDB search
MNGCASTLSGEGYSDAVAGCGLGRHKIVIAMQPVRISTTVYDREFNPVRYGSPAPNGKLS
PKGTRESGLGSLDEQNTTSNESSSTYESSSTKPTPAPQPQFTRKVAPTVKSSPPPKDRIS
ASSAEYVNVNQELLKEIQQTKILLQLALESKLRSEPNNDDKVQLVKLRQEIKELQNRISQ
TEVIRAIQEPIVQRQKVQQTSLNLVPQPKFVHQRKKAPLKPLQSETSDDYDTITLSRLVE
ESVPEVFTSEEDEPDPPKLPPPRISVSRLNNSDDHGDDDTSQDEEPTPPKLPPPRTPPEI
NGMITRAEHIQVSHETIKTIPEPTVPPPSRDPPPTPIEEPSPSKFPQQRESQDSNPPPKI
EELNNSRSGILKKARKEGVVSDKPEPKTSREIVIPSHPKTRDAELLIKKAITVNEFLNNL
MDEERLKAVTDAMSPMVFPPNSYIIKEGDIGAHFFVSAEGTYEVVVENKVIKSFGRGVVF
GELAILYKAKRFASIRVTTEAKVWMLERKIFQKIMMKSGRKEREENVKFLSTVSILRDLQ
IEKLHKISDLLKREFYATGSTIIQQGDPGDKFYIIRGGSVNVIKTDRSGTDKLVGTLQRG
AYFGEQALLHEDRRLASIVANPPGTECLTLNRIAFNEFLGGLEQLREIVLSDDIPRTSSS
RKTVSEYDHIQLHDLTYIGTLGIGGFGRVELVQCQDRKTFALKYLKKIEMVRQQQQEHAY
SEKDIMLSCNSPFIVRKDYNYVRDFLNNTKIEYYSHDDPGKRPMKQVIRALYDMDVSVLK
EELKTVKLNVIEVFKMTRHNKDIKYRDQLYLVHLEKGSTTPSELKAVGQFQHHRDLGTLS
SSAP
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgaatggatgtgcgtcaacgttgagtggggagggatattcggatgcggttgccggttgc
ggtcttggacgtcataagatcgttatcgcgatgcagcccgtccggataagcaccaccgtc
tacgatcgcgagttcaacccggtacgatatggatccccagcacccaacggaaaactatcc
ccaaagggcacccgcgagtccggccttggcagtctggacgagcaaaacaccacctccaac
gagtcctcctcgacgtacgaatccagctcaacgaagccaacccccgcgccacaacctcag
ttcactcgcaaagtggcacccacggtcaagagtagtcctccccccaaggaccggataagt
gccagctcggcggagtacgtaaacgtcaaccaggaactgctaaaggagatccagcaaacg
aaaatactcttgcagctggcgctggagtccaagctgaggagtgagcccaacaacgacgac
aaggtccagctggtcaagctgaggcaggagatcaaagaactccagaacaggatcagccag
acggaggtcattcgggcgatccaggaaccgatcgtgcaacgacagaaggtccagcagacc
agtttgaatctcgtcccgcagccaaagttcgtccaccagcgaaagaaggccccactgaag
cccctgcagtcggagacttcggacgattacgacacgataacgctgtccaggctggtggag
gagtccgtcccagaagtcttcacatcggaggaggacgagccggatccaccgaagctgcct
ccacctcggatcagcgtaagcaggcttaacaacagtgatgaccacggtgatgacgatacc
tcgcaggacgaggaacccacaccacccaagttacccccaccccggacaccacccgagatc
aacggcatgatcacccgagcggagcacatccaagtgagccatgaaacaataaagacgatc
ccagaacccacggttccacccccaagtcgcgatcctccaccgaccccaatcgaggaaccc
tctcccagcaagttcccccaacagcgagaatcccaagactcgaacccaccacccaagatc
gaagaactcaacaacagccggtcgggaatcctaaaaaaagctcgcaaagagggcgtcgtg
tcggacaagcccgagccgaaaacgtcccgcgagatcgtgatcccaagccatccaaaaact
cgtgacgccgaactactcatcaagaaggcgatcacggtgaacgagttcctgaacaacctc
atggacgaggaacggctcaaagccgttacggacgcgatgagtccgatggtgttcccaccc
aacagctacatcatcaaggagggcgacatcggggcgcactttttcgtgtccgccgagggg
acgtacgaggtggtggtcgagaacaaggtcatcaagtcctttggccgcggcgtggtattt
ggcgagctggctatcctgtacaaggcgaaacggttcgcgtcgattcgggtgaccaccgaa
gcgaaggtgtggatgctggagcgcaagatcttccagaagatcatgatgaagagcgggagg
aaggagcgcgaggaaaacgtcaagttcctgagtacggtgtcgattctgagggatctccag
atcgagaagctgcacaagatctccgacttgctgaagcgggaattctacgccaccggatcg
acgatcattcagcagggagacccgggcgataagttctacattatccgcgggggtagtgtg
aacgtgatcaagacggatcgcagtgggacggataagttggtggggacgctgcagaggggg
gcgtactttggggagcaggcgctgctgcacgaggatcgccggttggcaagcatcgtggca
aatccacccggaacggaatgcttgacgctgaatcgaatcgccttcaacgagttcctcggt
ggcctggagcagctccgtgagatagtcctgtcggacgatattccacgaacgtccagcagc
cggaaaactgtctccgagtacgaccacattcagctgcacgacctcacctacatcggcacg
ctcggcatcggtgggtttggccgcgtcgagctggttcagtgccaggaccggaaaacgttc
gccctcaaatacctcaagaagattgagatggttcgacagcagcagcaggagcacgcctac
agcgagaaggacatcatgctgagctgtaacagcccgtttatcgtgagaaaggattacaac
tacgttcgggatttcctgaacaacacaaagattgaatactacagccatgacgatccaggt
aaacgccccatgaaacaagtcatccgtgccctgtacgacatggatgtgagtgtgctgaaa
gaagagctcaaaactgttaagttgaacgtgatcgaagttttcaagatgacgagacacaac
aaggacatcaagtatcgtgatcaactgtacctggttcatctcgagaaaggatcgacaacg
ccgtctgagctgaaggcagtcgggcaatttcaacatcatcgtgacttgggaacgttatcg
tccagtgcaccgtga

DBGET integrated database retrieval system