KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006166Help
Entry
CpipJ_CPIJ006166  CDS       T01079                                 

Definition
deltamethrin resistance-associated NYD-GBE
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CpipJ_CPIJ006166
Enzymes [BR:cqu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CpipJ_CPIJ006166
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CpipJ_CPIJ006166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 689 aa AA seqDB search
MSQQLPVDPANPGIEKLLDLDGYLRLHETEIRRRNNELKNWIARFEQMEGGLEEFTQGYK
YYGLHIGADNSVTAREWAPGAKQLYLTGDFNNWQWEATPYKQLPYGKWELKIPPNQDGSC
PIKHLSEIKVIVRKQDGQLVDRLSPWAKYVVPPPKSLGVNYQQRVWHPPAHEKYMFRHRK
PARPRAMRIYECHVGIATEELGVGTYKNFADNVLPRIKHVGYNTIQVMAIMEHAYYASFG
YQITSFYAASSRFGTPEELKYMVDKAHELGMFVLLDVVHSHASKNTQDGLNQFDGTNACY
FHDGSRGEHSLWDSRLFNYSEFEVLRFLLSNLRWWRDEYGFDGYRFDGVTSMLYHSRGIG
EGFSGDYNEYFGLNVDTEALIYLGIANFFLHKLDPNVVTIAEDVSGMPTLCRPTAECGIG
FDARLGMAIPDKWIELLKGTSDEAWNIGNLVHTLTNRRYKETTVAYAESHDQALVGDKTI
AFWLMDKEMYTHMSIMSDASLIIDRGLSLHKMIRLITHSLGGEAYLNFMGNEFGHPEWLD
FPRIGNNESFHYARRQWHLIDDQNLKYRFLNEFDRVMNMTEEQHHWLNCNPAYVSCKHED
DKTIAAERNNLLFVFNFHCNKSFTDYRIGVERPGKYKVILSTDDKEFGGFDRIDKNVEHL
TFPEGWNGRRNSMHVYIPSRVAIVLAPVD
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagcaactcccggtcgatccggccaaccccggcatcgagaagctgctggacctt
gatggctatctgcggcttcacgagacggaaatccgccggagaaataatgagctcaagaac
tggattgcccgcttcgagcagatggagggtggactggaggagttcacccagggatacaag
tactacgggctgcacatcggcgcggacaacagtgttacagctcgcgagtgggcacccgga
gcgaagcagctgtatctgaccggggatttcaacaactggcaatgggaggccaccccgtac
aagcagctgccgtacggcaagtgggaactgaagattcccccgaaccaggacggttcctgc
ccaatcaagcatctgtcggaaatcaaggtgatcgtgcgcaagcaggacggtcagctggtc
gatcgcctctcgccgtgggccaaatacgtggttccgccaccaaagtcgctgggcgtcaac
taccagcagcgcgtttggcatcctccggctcacgaaaagtacatgttccgccaccgcaag
ccggcacggccccgtgccatgcgcatctacgagtgccacgtgggcattgctacggaggag
ttgggcgtcggtacgtacaagaactttgccgacaatgtgctgccgcggatcaagcacgtc
ggctacaacacgatccaggtgatggccattatggagcacgcgtactacgccagttttggg
tatcagattacgagcttctacgcggcgtcgagccggttcgggacgccggaggagttgaag
tacatggtggacaaggcgcacgagctgggcatgtttgtgctgctggatgtggtccactcg
catgccagtaagaacacgcaggacggtttgaaccagtttgacgggacgaatgcctgttat
ttccacgatggatcgcgcggagagcactcgctgtgggacagccgcttgttcaactattca
gaatttgaagttttacgttttctgctgtcgaatctgcgttggtggcgtgacgagtacggc
ttcgatgggtatcgcttcgacggagttacgtccatgttgtatcattcgcgtggtattggc
gaaggtttctccggggattacaacgagtactttgggctgaacgtggacacggaggcgttg
atctatctgggcattgcaaactttttcttacacaagctggatccgaacgtggttaccatc
gcggaggatgttagtggcatgccgacgctgtgtcgtcccacggccgagtgtggcatcgga
ttcgatgcacgcctgggaatggcaatcccggataagtggattgaactgctgaagggaacg
tcggatgaagcctggaacatcggaaatcttgtgcatacgttgacgaatcgccggtacaag
gaaactacggtcgcttacgccgagtcccacgatcaggccctggtgggtgataaaacgatc
gccttctggctgatggacaaggagatgtacacccacatgtcgataatgtctgacgcgagc
ttgatcatcgatcgtggcttgtcactgcacaagatgattcgtctgattacgcacagtttg
ggcggcgaagcgtacttgaactttatgggcaacgagttcggccatccggagtggctggac
tttccgcgtatcggcaacaacgaatcattccactacgcccgccgtcagtggcacttgatc
gatgatcaaaatctcaagtatcgcttcctgaacgagtttgatcgtgtcatgaacatgacc
gaggagcagcaccactggttgaactgcaacccggcgtacgtgagctgcaagcacgaggac
gacaaaacgatcgcggccgagcggaacaatctgctgttcgtgttcaacttccactgcaac
aagagcttcaccgattaccgcatcggggtggaacggcccggcaagtacaaggtgattctg
agcaccgacgacaaggagtttggtgggttcgaccggatcgacaaaaacgtggagcatctt
acattcccggagggctggaacggtcgccggaactctatgcacgtgtatattccgtcgcgt
gttgccatcgtgctagccccggtggattag

DBGET integrated database retrieval system