KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006285Help
Entry
CpipJ_CPIJ006285  CDS       T01079                                 

Definition
regulatory-associated protein of mTOR
Orthology
K07204  
regulatory associated protein of mTOR
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:cqu04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1197 aa AA seqDB search
MLRLGILTGNNLQKQYERWQPRARYKHSLDPTVEDVKKLCTSLRRNSKEERVLFHYNGHG
VPRPTVNGEIWVFNRTYTQYIPLSIYDLQTWMGAPSIYVYDCSNAGIIVNSFNTFAEQHE
KELEQMRARSGSTAGHSDPEAANRNSPSPPILGATTYKNCIQLAACAANQILPMNPQLPA
DLFTSCLTTPIRIALKWFILQSTSKLVPHVTEDLIDRIPGQLNDRRTMLGELNWIFTAIT
DTIAWNTLPRDLFQKLFRQDLLVASLFRNFLLAERILRSYDCTPISSPPLPQSYRHPMWS
AWDLALDLALSQLPDILEKNKRFKHSPFFEEQLTAFQVWLEGSSEQRSPPEQLPIVLQVL
LSQVHRLRALELLGHFLDLGPWAVNLALSVGIFPYVLKLLQSLAKELRPFLVFIWAKILA
VDGTCQIDLIRDQGHKYFLAALQDTSPCPGFKGNHRIYAAFVLASIVHNFPIGQANALQG
QLVSICLDQLNDENPVLRQWLTICLGHLWQNYEQARWSGVRDNANEKLYPLLSDPIPEVR
AAAVYALGTFISSVTQRSDHANNIDRSTAMHLFNTVCNDMSPLVRMELIASLQWMVRFFE
NQFVSVFLQETASGGHHVASNHHYHSLERTINIKRVSSTSNIINVGKNSVSVGSIYQKLW
NGLNALAKDPFPAVAAMAQKVVEHVGKQGYELAKEATTSEKCMSLPPSPNTRINYLGGES
PPIHGHLNQSTHHTPLPSKKKLGPISDGAELPTMTATPQATPQHPDQQMPPPPSTPQPVT
QQQPPTVTPIVTTNYIDWSVSFFARPSKFLNEGKLNTASDQNSTEYLDRQSRCLRNRIVR
DEGREQQRRAVFGRLDTQSWSCRTQHTPTMVKLNPYDDQIAVAYKDRVILQDWSTDITSS
FIPFKQQPSQQHQSIFLDQNRFQSTLPAPVSVSSLDFINAHDVGLVLVAYSDSVIRVWRP
ADANRESALVTAWHGLFDFNSPTTAKVGTSELGLVMAWHQKTQTIMAAGEAKYVRLWDAE
REMKVCDIPSGTDTTIIKLSCAPNGIFAAGCNDGSVRLFDRRCAPAEARFATFREHLNPI
LTVCLRDDCESLVSACTTSTVRLYDIRKTAASVQHWSAGSDVSAMSIHSSADIVACATSV
ITVYGLDGTSLNTIRCNEGFMGTKKGVTSCLSFHKHKLSLAAGFNDNTAAVFVTDRK
NT seq 3594 nt NT seq  +upstreamnt  +downstreamnt
atgttgaggctaggaattttgacaggaaacaacctccagaagcaatacgaacgctggcag
ccgcgggcccgctacaagcactcgctcgatccgaccgtcgaggacgtcaagaagctgtgc
acgtcgctgcgacgcaactcgaaggaggaacgcgtcctgttccactacaacggccacggc
gtgccgcgacccacggtgaacggcgaaatttgggtgttcaaccggacgtacacgcagtac
atcccgctgtcgatctacgacctgcaaacgtggatgggcgccccgtcgatctacgtgtac
gactgctcgaacgcgggcatcatcgtgaacagcttcaacacgttcgccgagcagcacgag
aaggagctggagcagatgcgggcacgcagcggcagcacggcgggtcattccgatccggaa
gctgcgaataggaactcgccttcgccgccgattctcggcgcgaccacgtacaagaattgc
attcaactggcggcctgcgccgccaatcagattttgccgatgaatccgcagctgccggcg
gatttgttcacgtcgtgtctcacgacaccgattcggatagcgctcaagtggttcatcctg
cagtccacatcgaagttggtgccgcacgtgacggaggatttgattgatcgcattccgggt
cagttgaacgatcggcggacaatgttgggcgagttgaattggatattcactgcgattacg
gacacaatcgcgtggaacacgcttcctcgggatttgttccagaagttgttccgccaggat
ctgctcgtggcgagtttgtttcgaaattttctgcttgcggagcgaattctgcgctcgtac
gactgtacgcccatctcgagtcctccgctgccgcagagctatcgacacccgatgtggtcc
gcgtgggatctggctctggatttggccctttcgcagttgccggacattctggagaagaac
aaacgcttcaaacattcgcccttcttcgaggagcagctgaccgcgttccaggtttggctt
gagggcagttcggagcagcgaagtccaccggagcagctgccgatagtgttgcaggtgctg
ctgtcgcaggttcatcgattgcgtgccttggagctgttgggacactttttggatttgggc
ccgtgggcggtgaatttggcgcttagcgtgggtattttcccgtatgtgttgaaactgttg
cagagtttggcgaaagagttgcgtccgtttttggtgtttatatgggcgaagatccttgcg
gtggacgggacgtgccagattgatttgattcgcgatcaaggacacaagtactttttggcg
gcgctacaagacactagtccgtgtccgggatttaagggcaatcatcggatttacgccgcg
ttcgtgctggccagcattgttcacaactttccgattggacaggcaaacgcactgcagggc
cagctggtgtccatctgcttggatcagttgaacgacgaaaatcctgtgctgcgacagtgg
ctgacgatctgtttgggacatctctggcaaaactacgagcaagctcggtggtccggtgta
agagacaatgcgaacgagaagttgtacccgctgttgagtgatcccattccggaagttcga
gcggcagctgtctacgcgctgggtacgttcataagctccgtaacgcaacgatcggatcac
gcgaataacatcgaccgatcgacggcgatgcacctgttcaacacggtttgcaacgacatg
agcccgttggtgcggatggaactgatcgcatctcttcagtggatggttcggttcttcgag
aatcagtttgtgtcggtgtttctacaggagacggccagcggaggccatcacgtagcctca
aatcaccactatcacagtttagagcggactattaacattaaacgtgtttcgagtactagt
aatataataaatgtaggcaaaaattccgttagtgtcggatctatttaccaaaagctgtgg
aacggtttgaacgctctcgcgaaggaccccttcccggcggtagcagccatggcccagaaa
gtggtagaacacgtcggcaaacaaggctacgaactggccaaggaggccaccacgtcggag
aagtgcatgagcttgccaccctcaccaaacacccgcatcaactatctcggcggagaatcc
cctccgatccacggccatctaaaccaatccactcaccacacaccactcccaagcaaaaag
aagctcggccccatcagcgacggcgccgaactacccacaatgaccgcaacaccccaagca
actccacagcatccggaccaacaaatgcctccgccgccgtcgacgccgcaaccggtgacg
cagcaacagccaccgaccgtcacccctatcgtcaccaccaactacatcgactggtcggtg
agcttcttcgcgcgcccctccaagttcctcaacgagggcaaactcaacacggcgtccgat
caaaactcgaccgagtacctggaccggcagtcgcgctgtctgcgaaaccggatcgtccgc
gacgagggacgcgagcagcagcgacgggccgtgtttggccggctggacacgcagagttgg
tcctgccggacgcagcacacgcccaccatggtgaagctgaacccgtacgacgatcagatt
gcggtcgcttacaaggaccgcgtaatcctgcaagattggagcacggacatcaccagttcg
ttcattccgttcaagcagcaaccgtcgcagcagcaccagtcgatttttctcgaccagaac
cggttccaaagcacgctacccgcgcccgtctccgtttcctcgctcgactttatcaacgcc
cacgacgtcggcctggtgctggtggcctacagtgacagcgtgatccgggtgtggcgtccg
gcggatgcgaaccgggagtctgccctggtcaccgcgtggcacgggctgttcgacttcaac
tcgcccaccacggccaaggtcggcacgagtgagctgggcctggtgatggcgtggcatcaa
aagacgcaaacaattatggcggccggcgaggccaagtacgttcggctgtgggacgccgag
cgggaaatgaaagtctgtgatatcccgagcgggacggacacgaccatcatcaagctgtcg
tgcgcgccgaacggcatctttgcggccggctgtaacgacggcagtgtgaggttgttcgat
cgaaggtgtgcccctgcggaagcacggttcgccacattccgcgagcatttgaacccaatt
ttaaccgtttgcctgcgggacgactgcgaaagcctagtgtcggcgtgtacaacgtccacc
gtgcggttgtacgacatccggaagacggccgcatcggttcagcactggagtgccgggtcg
gacgtttccgccatgagcatccactcgagtgcggacattgtggcgtgcgcaacgagcgtc
atcaccgtgtacggactggacggaactagtctgaacacgatccggtgcaacgagggattc
atgggcaccaagaagggtgtcacgtcgtgtttgtcgttccacaagcacaaactcagcctg
gcggcaggtttcaacgataacacggcggccgtgttcgtgacggaccggaaatga

DBGET integrated database retrieval system