KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006394Help
Entry
CpipJ_CPIJ006394  CDS       T01079                                 

Definition
phorbol ester/diacylglycerol-binding protein unc-13
Orthology
K15293  
protein unc-13
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 2420 aa AA seqDB search
MKEQHQEVDRSFSVDIKREEIINSQIRRYSSYSPYCSPYATRSLERTTACTVQDLYASHG
LKDLHHLHQDFIINDYTDKIATNIDLLDTELKFAWAALNLLNEEYTRMSEKVFKLQSLNV
SQQRIVQNLQFMEENRKAYLDMIPDYAKHHEFSLQEQSRLREDLQYRDCINEAYMNHMQP
GPAYGYGQVPSAEEMAAAYNQEYWGMRRNLSNIPEVLHGEAENGGGGAYGYGQDVPMPAP
QAHRLSTNPFLQVVEGAGGILREIEPADNAALIEEQLRASFLNHAKQMEMELQASPAMMK
HQQELRQQQQQQQLLQQKQFKHDDVRALITRVMDDEDVASLSSEEMEKVRVFMSKNSGEL
REIFAEEFSPLAKVGKGGEKILAQNKLGGVSPKKEFNKFIHLPDAAGIASLTNDDLLTVE
NGTISIQDKSSTTIADNEFKLNLNSGGVVHPANGTNGTSPKKLSEFSPFGMQKAMERKES
GNVPSFADLMNSKPCGTDAAGLTFTNLNGEPESIFSQSFKEAVEAKLAGQAVQMAGNMMS
MGEPVPMFPTVAMKPNISEALEGGGVRRPSVTEALEIRRPSVTESLFPTVARKPSITTTS
VASELQRRLSVEDPQHPSAFAPVRKLSIVEPVADPAPTAPSIFQPLARKPSVTETAAPST
SPPMFTPLPGCTTITDTPEMQAIYESLSRKSSLPTLGDGTFFPSLDITDSGFAECTDGMS
LFPTTLTLSTTLSSTTDAPVSLPDFSTLSTMAAETSEASNSSFLHMSMNSSGISEASDSI
TLLPPVSAILVTTDQSTIAVPKPAEPAPPPLPQPLPPISAAPATMAALADSKPIAQATAP
PPTVTSPPAPLATAEVVKPKPTAAAAVTKPTPAAVPPTAVTKPTPVAQAPTKPQPAPVPK
PAPQQPTPEAKQAGGFFGTTTSTFGGFFNKVNKSLSHQDSTDSLLGTKTKALFSSVKSSF
SLESPKQSLDEANSQPSSSQSATSGAASLESSSPPGSVQVPSTPEEPHSTTPPPSPDVAL
AQSHQQQQQQQLQPHQQSSPPQELQQYPQTSPPGGGEQQQSSPYDQPQLASEFPELCNGN
GSSGTPLSNSAQPFPGAAAEETVLDGEAPAPPTHRKQSLFRAQGSEDGEGGSKWKLLKTL
KEKRIEEKQKVVDEGEADDAGIFKKVDCKAEEEEKRNGTADSGRGNGLGDNTFYSNIDSM
PDIRPRRKSIPLVSELTMAATKRQAGLTSAVPRATLNDEELKMHVYKKALQALIYPISST
TPHNFVLWTATSPTYCYECEGLLWGIARQGVRCTECAVKCHEKCKDLLNADCLQMCFAGA
SEKSSKHGAAEDKANSVIAAMKERMKQRERDRPEIFEVIRKVFNVEEKSHAGHMKAIKQS
VLDGTSKWSAKIAITVICAQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEK
FNFECHNSSDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLE
KRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENVFHYLCEENCGAVNLPQTKGD
DGWKIYFEENPEEIVDEFAMRYGIENIYQAMTHFHCLSTKYLCAGVPAVMSTLLANINAY
YAHTTASSAVSASDRFAASNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSQEKLMDLK
STVDLLTSITFFRMKVQELSSPPRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDP
NEAKREGEDHGPKLENVDFWHKLIALIVSVIEEDKNSYSAVLNQFPQELNIGQVSAATMW
SLFAIDMKYALEEHEQHRLCKSSAYMNLHFKVKWLYTNYVKEVPPYKGAVPEYPAWFEPF
VMQWLNENDDVSLEYLHGAFKRDKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLDC
PDPEIWKRYMRRFAKTIVKVLLAYVDIVKTEFPDITHEERTACILMNNIQQLRVQLEKMF
DSMGGDKLEEDAANILKELQQNLNTALDDLATQFAISLDPRITGSVRELGDLLQQVKSQT
SLFHSAPADDANMIAMEADEVLRPLMDLLDGSLSMYAQSCEKTVLKRLLKELWKIVIRTL
EKTIVLPPMTDRTMVFKHLTDNAKNLAANAKIEDMSRLIKNHMAGKQDAKSMLGGVMDIS
KEIEKNLSPKQCAVLEVALDTIQQYFHAGGNGLKKPFLEKSSELQSLKYALSLYTQTTDT
LIKSFVSGQGASEEGGINHDDASVGEVSIQIDVSSNPENGEQKISVKVIAANDLKWTVPS
GMFRPFIEVNLIGPHLNDRKRKFATKSKSNNWSPKYNETFHFIIGNEEQLEFFELHTCVK
DYCFAREDRLVGVAILKLKDVVDQVTGTDYGLRLSECCVRESVDTEEYHVLVWGFLSYLG
GEISDPVKRLEDRESSTRFV
NT seq 7263 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacaacatcaggaggtggatcgttccttttccgtggatatcaaacgtgaggaa
ataatcaactctcaaattcgcaggtattctagctactcgccgtactgtagcccgtacgct
acccggagtctagagcgcacgacggcctgcacagtccaggacctgtacgcgagccatggc
ctcaaggatctgcaccacctgcaccaggactttatcatcaacgattacacggacaagatc
gcgacgaacatcgacctgctcgacacggagctcaagtttgcgtgggccgcgctgaacctg
ctcaacgaggagtacacccggatgtcggagaaggtgttcaagctgcagtcgctgaacgtg
tcccagcagcggatcgtgcagaacctgcagttcatggaggagaaccgcaaggcgtacctg
gacatgatcccggactacgccaagcaccacgagttctcgctgcaggaacagtcgaggctg
cgcgaagatctgcagtaccgggactgtatcaacgaggcgtacatgaaccacatgcaacca
gggccggcttacgggtacgggcaggtcccgtcggcggaggagatggccgcggcttataat
caggagtactggggcatgcggcggaatctgtccaacatcccggaggtgctccacggggaa
gcggagaatggtggtggtggggcgtacgggtacgggcaggacgtgccgatgccggctccg
caagcccatcgactgtcgacgaatccgttcttgcaggtggtcgaaggagctggcgggata
ttgagggagattgaacccgcggacaacgccgcgttgatagaggagcagttgcgggcgtcg
ttcttgaaccacgccaagcagatggagatggaactgcaggcttcgcctgctatgatgaag
catcagcaggagttaaggcagcagcagcagcagcaacagctgctgcagcagaagcagttc
aagcacgacgatgtgagggcactgattacgagggttatggacgacgaggacgtggcgtcg
ttgagcagcgaagagatggagaaggtgagggtgtttatgtcgaagaacagtggcgagttg
agggagatattcgcggaggagttctcaccgctggcgaaggtcgggaaggggggtgagaag
atcctggcgcagaacaagctgggcggggttagcccgaagaaggagttcaacaagttcatt
cacctgccggatgctgctgggatcgcctcgttgacgaacgacgacctgctgacggtggaa
aacgggacaatcagtattcaggacaagagtagcacaacaatcgccgacaacgaattcaag
ctcaacctgaacagcggcggcgtagtccatccggcgaacgggacgaacggaacgtcaccg
aagaagctgagcgagttttcgccgttcgggatgcagaaggccatggagaggaaggagagc
ggcaacgtgccgagctttgccgacctgatgaacagcaaaccgtgcggcacggatgcggct
gggttgacgtttacgaacctgaacggcgaaccggagtcgatcttcagccaaagcttcaag
gaggcggtcgaggcgaaacttgcggggcaggcggtccagatggcgggtaacatgatgagc
atgggagaaccggttccgatgttcccgacggtcgcgatgaagccaaacattagtgaagcg
ctggaggggggcggcgtgcggcggccaagcgtaacggaagcgctcgaaattagacggccc
agcgttaccgaatccctgttcccaactgtagctaggaaaccaagtattacgacgacgtcg
gtagcgtcggaactccagcgaagactatccgtagaagatccccagcatccgtcggctttc
gcgcccgtccgcaagctgagcatcgtggaaccggttgcggatccggctccgaccgcccca
agcatcttccaaccgttagctagaaaacccagcgtcacggaaactgccgccccttcgacg
agccctccaatgtttacgccgctgccgggctgcaccaccatcacggacacgccggagatg
caagccatctacgaatcactgtcccgcaagtccagccttcccaccctcggtgacggcacg
ttcttcccgtcgctggacattaccgactcgggctttgccgagtgcaccgacgggatgtcc
ctctttccaaccaccctgaccctgtcgacgacgctgtcttccaccaccgatgcgcccgtc
tcgctgccggacttttccaccctgtcgaccatggccgccgaaacgtccgaggcgtccaac
tcgtcgtttctgcacatgtcgatgaactcgtccggcatcagcgaagcatcggacagtatc
acgctgctgccaccggtaagtgccatcctcgtcaccactgaccaatcgacgatcgccgta
ccgaaaccggcggaacctgcgccgccgccgctgccacaacccttaccacccatatcagcc
gctccggccacgatggcggccctcgccgacagcaaaccgatcgcacaagccactgctcct
cctccgacggtcacctcgccaccggctcctctggccaccgccgaggtcgtcaaaccaaag
ccgactgcggccgccgctgtaaccaagccgactccggctgcggtaccaccaaccgctgta
accaagccgactccggttgcacaggctcccacgaaaccacagccagcgcccgttccgaag
ccagcgccgcagcaacccaccccggaagccaagcaggccggcggcttcttcggcacgacc
acctccaccttcggtggcttcttcaacaaggtcaacaaaagtctgtcccaccaggacagc
accgacagcctgctcggcaccaaaaccaaggcgctcttctcctccgtcaagagttccttc
tcgctggagtcgcccaagcagtcgctcgacgaagccaactcccagccgtcgtcctcgcag
tccgccacctcaggggccgcctcgctcgagtcgtcgtccccgcccggtagcgtacaggta
ccgtcgacgccagaagaaccacactccactactccacccccatctccagatgtagctctg
gctcagtcccaccaacaacaacaacaacaacaacttcagccacaccaacagagttcgcca
cctcaggaactgcagcagtacccgcagacgtcacccccgggcggcggcgaacaacaacag
tcttccccgtacgaccagccgcagctagcttcggagtttccggagctgtgcaacggcaac
ggcagtagcggcaccccactgtccaatagcgcacaaccgtttcccggtgcggcggcagag
gaaacggtactcgacggcgaagcgcccgcaccgccaacgcacagaaagcagagcctgttt
cgggcgcaggggagtgaagatggggaaggagggagcaagtggaagctgctgaagacgctg
aaggagaagcggatcgaggagaagcagaaggtggtcgacgaaggtgaagcggacgatgca
ggtattttcaagaaggtcgattgcaaggcggaggaagaagagaaacgtaacggaaccgcg
gacagtggacgcggcaatgggctcggggacaacaccttctacagtaacatcgacagcatg
ccggatatccgtccacggcgcaagtcgatcccgctggtgtcggagctgacgatggcagct
acgaaacgtcaggccggtctcacctcggcggttccgcgagcaaccctgaacgatgaggaa
ctgaaaatgcacgtctacaagaaggccctccaggcgctgatctacccgatctcgtccacg
acgccgcacaactttgtcctgtggacggccacctcaccgacctactgctacgagtgcgag
ggtctactctggggtatcgcccggcagggcgtccgctgtaccgagtgtgccgtcaagtgc
cacgaaaagtgcaaggacctgctgaacgcggattgtttgcagatgtgcttcgcgggagcg
tctgagaagagttccaaacatggggccgccgaggacaaggccaactccgtgatcgctgcc
atgaaggagcgcatgaagcagcgcgagcgggatcgaccggagatcttcgaggttatcagg
aaggtgttcaacgtggaagagaagagccacgccggccacatgaaggcgatcaagcagagc
gtgctggacggtacgagcaagtggtcggccaagatcgcgatcacggtgatctgcgcgcag
ggtctgatcgcgaaggacaagagcggcaccagcgatccgtacgtgacggtgcaggtgagc
aaggtgaagaagcgtacgcggacgatgccgcaggagctgaacccggtgtggaacgagaag
tttaacttcgaatgccacaactcgtccgaccggatcaaggtgcgcgtctgggacgaggac
aacgacctcaagtcgaagctgcggcagaagctgacgcgcgagtcggacgacttcctgggg
cagacaatcatcgaggtgcggacgctgtcgggcgagatggacgtgtggtacaacctggag
aagcgaacagacaaatcagcggtatcgggcgcaatccggctgcacatttcggtggagatc
aagggcgaggagaaggtggcgccgtaccacgtgcagtacacctgcctgcacgagaacgtg
ttccactatctctgcgaggagaactgcggggcggtcaacctgccgcagaccaagggcgac
gacggctggaagatctacttcgaggagaacccggaggagatcgtggacgagttcgcgatg
cggtacggcatcgagaacatctaccaagcgatgacgcacttccattgcctctcgaccaag
tacctgtgcgcgggcgtgccggccgtgatgagtaccttactagcgaacattaacgcttac
tacgcacacacgactgcttctagcgccgtctcggcgagtgaccgcttcgccgccagcaac
tttggcaaagaaaaattcgtaaaactattggaccagttacacaactctctccgtatcgat
ttgtctatgtatcgcaacaacttccccgcttccagccaagaaaagctgatggacctcaag
tccacggtcgatctactaaccagtattacatttttccgcatgaaggtacaagaattgtcg
agcccacctagagccagcacagtggtcaaggactgcgtgaaggcctgtctacgctcaacg
taccagttcctgttcgagaactgctacgagttgtacaatcgagaatttcaggtcgacccg
aacgaggcgaagcgcgagggggaagaccacggaccaaagctagagaacgttgacttttgg
cacaaactaatcgcactaatcgtatcggtaatagaggaggataagaatagttatagcgca
gtgcttaatcaattcccgcaggagcttaatataggacaggtctccgccgccacgatgtgg
agcctgtttgcgatagatatgaagtacgcgctggaggagcacgagcagcaccggctgtgc
aagtcgtccgcgtacatgaacctgcacttcaaggtcaagtggctgtatacgaactacgtg
aaggaggtcccaccgtacaagggcgccgtgcccgagtatcccgcctggttcgagccgttc
gtgatgcagtggctcaacgagaacgacgacgtctcgctcgagtacctgcacggggcgttc
aagcgggacaagaaggacgggttccaaaagagcagcgagcacgccctcttctccaactcg
gtcgtggacgtgttcacccagctgacgcagtgcttcgatgtagttagcaaactggactgc
ccggatccggagatctggaagcggtacatgcgacgattcgccaaaactatcgtaaaggtg
ttactagcttacgtagatatagttaaaaccgaatttcccgatatcacgcatgaagaaaga
acggcttgtattttaatgaacaatatccaacaacttcgggtccaattggagaagatgttt
gactcgatggggggcgacaagctggaggaggacgccgccaacatcctgaaggagctgcag
cagaacctgaacaccgcgctggacgacctggcgacgcagttcgccatcagcttggacccc
cgcatcacgggcagcgtccgcgagctgggcgacctgctgcagcaggtcaagtcgcagacg
tcgctgttccactcggcccccgccgacgacgccaacatgatcgcgatggaggcggacgag
gtgctgcggccgctgatggacctgctcgacgggtcgctctcgatgtacgcccagtcctgc
gagaagacggtgctgaagcgactgctgaaggagctctggaagatcgtcatccggacgctg
gagaagacgatcgtgctgccgccgatgacggaccggacgatggtcttcaagcacctgacg
gacaacgccaagaatctggctgccaacgcgaagatcgaggacatgtcgcgactgatcaag
aaccacatggccggcaagcaggacgccaagagtatgcttggcggtgtcatggatatctcc
aaggagatcgagaagaacctctcgccgaagcagtgcgccgtactggaggtcgccctggac
accatccagcagtacttccacgccggtggaaacggcctcaagaagccgttcctggaaaag
tcgtcggagctgcagagcctcaagtacgccctgagcctgtacacgcagacgacggacacg
ctgatcaagtcgttcgtgtcaggacagggcgcttccgaggaaggcggcatcaaccacgac
gacgcttcggtcggtgaggtctcgatccagattgacgtttcgtccaacccggagaacggc
gaacagaagatatccgtcaaagtaatcgccgccaacgatctcaagtggacggttccgtcc
ggcatgttccggccgttcatcgaggtgaacctgatcgggccccacctgaacgaccggaag
cgcaagtttgccaccaagtccaagtcgaacaactggtcgcccaagtacaacgaaacgttc
catttcatcattggcaacgaggaacagctggagttcttcgagctgcacacgtgcgtcaag
gattactgctttgcccgcgaggatcggctggtcggagtggcgatcctgaagctgaaggac
gttgtcgatcaggtaactgggacggattacgggttgagactgagtgaatgttgtgtgaga
gagagtgtggatacggaagaataccatgttttggtttggggatttttgagttatttaggt
ggagagatcagcgatcctgtcaaaaggttggaagatcgagaaagctcaacgaggttcgtg
taa

DBGET integrated database retrieval system