KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006455Help
Entry
CpipJ_CPIJ006455  CDS       T01079                                 

Definition
(RefSeq) enoyl-CoA hydratase, mitochondrial
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00062  Fatty acid elongation
cqu00071  Fatty acid degradation
cqu00280  Valine, leucine and isoleucine degradation
cqu00310  Lysine degradation
cqu00380  Tryptophan metabolism
cqu00410  beta-Alanine metabolism
cqu00640  Propanoate metabolism
cqu00650  Butanoate metabolism
cqu01100  Metabolic pathways
cqu01200  Carbon metabolism
cqu01212  Fatty acid metabolism
Module
cqu_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
cqu_M00085  Fatty acid biosynthesis, elongation, mitochondria
cqu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CpipJ_CPIJ006455
   00650 Butanoate metabolism
    CpipJ_CPIJ006455
  Lipid metabolism
   00062 Fatty acid elongation
    CpipJ_CPIJ006455
   00071 Fatty acid degradation
    CpipJ_CPIJ006455
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CpipJ_CPIJ006455
   00310 Lysine degradation
    CpipJ_CPIJ006455
   00380 Tryptophan metabolism
    CpipJ_CPIJ006455
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CpipJ_CPIJ006455
Enzymes [BR:cqu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CpipJ_CPIJ006455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 6038541
NCBI-ProteinID: XP_001848328
VectorBase: CPIJ006455
UniProt: B0WHZ4
AA seq 293 aa AA seqDB search
MANIGKIFASRACGLAKAANYSNNVRFYCCASPKAFEFIKTELVGEKKNVALITLNRPKA
LNALCNGLMSEVSQALDQFEADSTVGAIVITGSEKAFAAGADIKEMQPNTYAKCIMGNFL
NNWTRVAQAQKPVIAAVNGYALGGGCEFAMMCDIIYAGDKAKFGQPEIALGTIPGAGGSQ
RTTRVMGKSKAMEMCLTGNMINAEEAERSGLVSKVFPADKVVGEAIKLGEKISTFSPLIV
QLCKEAVNTAYETTLHEGLKFERRHFHATFSTKDRQEGMTAFVEKRAPKFISE
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacattggcaagatttttgcttcccgtgcctgcggcctggccaaggcggccaac
tacagcaacaatgtgcgcttctactgctgcgcttccccgaaggcgttcgagttcatcaag
accgagctggtgggtgagaagaagaacgtcgccctgatcacgctgaaccgccccaaggcc
ctgaacgccctctgcaatgggctgatgagcgaggttagccaggcgctggaccagttcgaa
gccgacagcaccgtcggagcgatcgtcatcaccggcagcgagaaggcgttcgcggcggga
gccgacatcaaggagatgcagccaaacacctacgccaagtgcatcatgggtaacttcctg
aacaactggacgcgcgtcgcccaggcccaaaagccggtgatcgccgccgtcaacgggtac
gccctcggcggtgggtgcgagttcgccatgatgtgcgacatcatctacgccggcgacaag
gccaagttcggccagccggagattgccctcggaacgattcccggagccggcggttcccag
cgcaccacccgtgtcatgggcaagtccaaggccatggagatgtgtctcaccggaaacatg
atcaacgctgaggaagcggaacgctccgggctcgttagcaaggtcttccccgccgataag
gtcgttggagaagccatcaagctgggcgagaagatctccaccttctccccgctgatcgtg
cagctgtgcaaggaagcggtcaacacggcgtacgaaaccaccctccacgagggactcaag
ttcgagcgtcgccacttccacgccaccttctcgaccaaggatcgccaggagggtatgacc
gcgttcgttgagaagcgtgcgcccaagttcatcagcgaataa

DBGET integrated database retrieval system