KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006484Help
Entry
CpipJ_CPIJ006484  CDS       T01079                                 

Definition
polycomb protein E(z)
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CpipJ_CPIJ006484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 763 aa AA seqDB search
MMSKTKLTLDWKKRVKSEYMKIRASKRHKRADEVKAAWNGNRQKLLNLLVMENDSWLTTN
ATWIQNDTELPHVECMKKAEVVNHEGAHQTIPIRVIPAVTPIPTMYTWAPTQQNFMVEDE
TVLHNIPYMGDEVLDQDGSFIEELIKNYDGKVHGDKEGSFIDDSIFVELCHALMQYTGRD
VDSNSNDSSKSGKAAAVKPTADDAAGPQPSTSGTKVPPAKAKPDKDEGTVDIAAKDDSLP
KFKLEPFVVLKKEVIDEKPFPSPIIFQAISSQFPDLGTPEELRERYIELTERVDPERPPE
CTPNIDGPRAESVSREQTLHSYHTLFCRRCFKYDCFLHRLQACHPGPNLQKRRWPELKQT
TKPCSATCYMLLDGMKERLAVDNKNKTPMDSGNEASSEDSNDSSRYSKEAPVIPGTAVAV
ASNGGTTTRLSTSVNNSATLLNLLDAADEEWNGSDKSFFRSLQTIYLNNYCAIAEAMLMK
TCQQVYQFAQKEAADIPLIETNKDNTPPRKKKKKHRLWSMHCRKIQLKKDSSSNHVYNFT
PCDHPGPCDASCPCIRAQNFCEKFCNCSSDCQNRFPGCRCKAQCNTKQCPCYLAVRECDP
DLCQTCGAEHYEISKITCKNVSVQRALHKHLLMAPSDVAGWGIFLKESAQKNEFISEYCG
EIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSINPNCYAKVMMVN
GDHRIGIFAKRAIQPGEELFFDYRYGPTEQLKFVGIEREMEFL
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccaaaaccaagctgacgctggactggaagaagcgcgtcaagtccgagtacatg
aagattcgcgccagcaagcgtcacaagcgcgcggacgaggtgaaggccgcctggaacggg
aaccgtcaaaagttgctgaatttgctggtgatggagaatgactcgtggctgacgacgaac
gccacctggatccagaacgacacggaactgccccacgtcgagtgtatgaagaaggcggaa
gtggtgaatcatgagggcgcccaccagacgattccgatccgggtgattccggcggtgaca
ccgattccgacaatgtacacgtgggcgccgacccagcagaacttcatggtcgaagatgaa
accgtgctgcacaacattccttacatgggagacgaggtgctggaccaggacgggtcgttc
atcgaggagttgataaagaattatgacggaaaggtgcacggggacaaggagggcagtttc
attgacgattccatctttgtggagttgtgccacgcgttgatgcagtacaccggcagggac
gtggactcgaacagcaacgatagctcaaagtcgggaaaggctgccgcagtgaagccgacg
gcggatgatgctgccggaccacagccatcaacgagtggcacgaaggtgccgccggccaaa
gccaaaccagacaaagacgaaggtaccgtcgacattgccgcgaaggacgattcactgcct
aaattcaagctggaaccttttgtagtactcaagaaggaagttatcgacgagaagccgttt
ccctcgccgataatcttccaggccatcagctcgcagttcccggacctgggcacgccggag
gaactgcgcgagcggtacatcgagctgacggagcgcgtcgacccggagcggcccccggag
tgcacgcccaacatcgacgggccgcgcgccgagtcggtttcgcgcgagcaaacgctccac
tcgtaccacacgctgttctgccggcgttgcttcaaatacgattgctttttgcaccgtctc
caggcgtgccatccgggaccgaacctgcagaagcgccgctggcccgagctgaagcagacg
accaaaccgtgcagcgcgacctgctacatgctgttggacggcatgaaggagcggctggcc
gtggacaacaagaacaaaacgccgatggattcgggcaacgaggccagctcggaggacagc
aacgacagcagccggtacagcaaggaggcccccgttattccgggaaccgcggtcgcggtc
gcttccaacggcggcaccaccacccgcttgagcacttcggtcaacaactcggccacgctg
ctgaacctgctggacgcggccgacgaggagtggaacgggtcggacaagtcgttcttccgc
tcgctgcagacgatctacctgaacaactactgcgccattgcggaggcgatgctgatgaag
acgtgccagcaggtgtaccagtttgcgcagaaggaggccgcggacattccgctgatcgag
acgaacaaggacaacacgccaccgcgcaagaagaagaagaagcaccggctgtggtcgatg
cactgtcgcaagattcagctgaagaaggactcgagctcgaaccacgtgtacaactttacg
ccgtgcgaccatccgggcccgtgtgacgcgagctgtccgtgcatccgggcgcaaaacttt
tgcgaaaagttctgcaactgcagcagcgactgccagaaccggttcccgggctgccggtgc
aaggcgcagtgcaacacgaagcagtgcccgtgctatctggcggtgcgcgagtgcgacccg
gacctgtgccagacgtgcggcgcggagcactacgagatctcgaaaatcacctgcaagaac
gtcagcgtgcagcgggcgttgcataagcacctgctgatggcgccgtcggacgtggctggg
tggggaatcttcctgaaggagagcgcccagaagaacgagttcatctcggagtattgcggt
gagatcatctcgcaggacgaggccgatcgccgcggcaaggtgtacgacaagtacatgtgc
agtttcctgttcaacctgaacaatgactttgtcgtggacgcgacccgcaagggcaacaag
atccgcttcgccaaccactcgatcaacccgaactgctacgcgaaggtgatgatggtgaac
ggtgatcaccgcattggaatctttgccaaacgcgccatccaaccgggggaggagctgttc
ttcgactacagatatggaccgaccgaacagcttaagtttgtcggcatcgagcgggaaatg
gagtttctctaa

DBGET integrated database retrieval system