KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006569Help
Entry
CpipJ_CPIJ006569  CDS       T01079                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cqu00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cqu00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:cqu00471]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 640 aa AA seqDB search
MSTLAGPDQLGKVWQEASILPGSYFVFSRANMDKLTDVENSDREEEILSGKGAAIPPKQR
EAFVKLLANFIRQRDTDKKHAEDLLFDMFKNEETGLLNIGKFLAALRTIGIRRNDPRIGE
MMDNLKKVHKLNNYDGGSPLSQNLNAETFKAVIAPNIVLIARAFRHQFVIPDFQGFTKDI
EEVYWKCKSNTDGKVASYIPQLARVNPDYWGVSVCTIDGQRFSIGDSNVPFTLQSCSKPL
TYAIALEKLGPKLVHQYVGQEPSGRNFNELVLDHTKKPHNPMINAGSILTCSLLKTLVHP
EMTLAEKFDYTQNWFSRMAGNEPLGFNNAVFLSEREAADRNYALGFYMREHKCYPEKANL
RECMDFYFQCCSMEATCETLAIMASTLANGGICPLTEEKVLQSENVRDVLSLMHSCGMYD
FSGEFAFKVGLPAKSGVCGGVMLVIPNVMGIFMWSPPLDPLGNSCRGVQFCEELVNIFNF
HLYDNLKHGSNKKDPRRHRYETKGLSVVNLLFSAASGDVTALRRHKLSGMDITLSDYDGR
TALHLACSEGHLECVKFLLEHCGVPHDAKDRWGNRPIDEAETFGHVEVVDFLKEWNDKVE
LAKKLGNETGYNSDQDSVKSGSSGGIFTPKTLKSTHSSVY
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgctggccgggccggaccagttgggcaaggtttggcaagaagctagcattctc
cccgggagttacttcgttttttcgcgtgcaaacatggataagttaaccgacgtggaaaat
tccgaccgcgaagaggaaattttaagcggaaagggcgccgccattccgccgaaacagcgt
gaagctttcgtaaagttgctggccaatttcataagacaacgcgacacggacaagaaacat
gcggaagatctcttattcgatatgttcaaaaatgaagaaacaggactcctcaacattgga
aaatttctggcggcccttcgcacgatcggcatccgccggaacgatccccgcatcggtgag
atgatggacaacctgaaaaaggtccacaagctgaacaattacgacggcggttctccgctg
tcgcagaatcttaacgcggaaacgttcaaggcggtcatcgcgcccaacatcgtgctgatt
gcccgggccttccggcaccagtttgtgattccggactttcagggctttacgaaggacatc
gaggaggtgtactggaagtgcaagagtaataccgacggcaaggtggcgagttacattccg
cagttggcgcgtgtcaatccggactattggggagtgagcgtgtgtacgatcgatggccag
cggttctcgattggggactcgaacgtgccctttacgctgcagagttgcagcaaaccgttg
acgtacgcgatcgctttggagaagttgggaccaaagttggtgcatcagtacgttggccag
gagcccagtgggcggaactttaacgagttggttctggatcatacgaagaagccgcacaat
ccgatgatcaacgccggctcaattctgacctgttcgctgctgaagacgttggtccacccg
gagatgacgttggcggagaagttcgactacacccagaattggttcagcagaatggcggga
aatgaaccgttgggcttcaacaatgcggtattcttgtcggaacgcgaagccgctgatcgg
aactacgcgcttgggttttatatgcgcgagcacaaatgctatccggagaaggccaacctg
cgcgagtgcatggacttttacttccagtgctgctcgatggaagctacctgcgaaacgctg
gcaattatggcctccacgctggccaacggtggcatctgtccgctgactgaggagaaggtc
ctccagtcggaaaatgtccgcgatgtcctgtcgctgatgcactcctgcggcatgtacgac
ttttccggcgaatttgcgttcaaagtgggacttccggccaaatccggagtgtgcggcggt
gtgatgctcgttatccccaacgtaatgggcatcttcatgtggtcacctccgctggacccg
ctcggcaatagctgtcggggcgtgcagttctgcgaggaactcgtcaacatcttcaacttt
cacctgtacgacaatctcaagcacggctccaacaagaaggatccgcgccgtcatcggtac
gaaaccaagggtctttccgtggtgaacctcctattttcagccgccagcggagacgtgacc
gccctgcggagacacaagctgtccggaatggacattacgctgtcggattacgatggtcga
acggccctccatctggcctgttccgagggtcacctcgagtgcgtcaagttcctactggaa
cattgcggcgtgccacatgacgccaaggatcggtggggaaaccggcccatcgatgaggct
gagacgtttggacacgtggaagtggtggactttttgaaggagtggaacgacaaggttgag
ttggctaaaaagctgggcaatgaaacgggatataattcggaccaggacagtgtcaagagt
gggtcatcgggagggatcttcacgcccaagaccctgaagtcaacgcactcgtctgtatat
tga

DBGET integrated database retrieval system