KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006590Help
Entry
CpipJ_CPIJ006590  CDS       T01079                                 

Definition
filamin
Orthology
K04437  
filamin
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CpipJ_CPIJ006590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 519 aa AA seqDB search
MLTTRPERLGSPWNINIMSSPGLTALGESTRLVPANVPAVFEVLPPPGASIRGSDCVATV
LSPSKSKVNARVTHEAANGALRIEFVPAEVGTHIIEASIGGTTLVGGPLIAKVYDSSLIQ
VTDVNGGVVGQPCQFRVDASAAGEGQLEISINEGEVPNHVQVVGGGRCLVSFTPEQAKPH
LIDIKFNGETVIGCPFVCSVADTSRVLLNLSNLELIPVNRPASFHITVSGGGAAELAVSV
RGPQGELPVRVTGDIHAGFTAEFTPNHVGAHTINVEYNGYPVQGTPFVAKSYDATKVAVG
SVSKGTVGRPVQFTVDAGDAGEGNLEITISAKGHNIPTQVHPQGNAKFAVSFVPAEPCEH
IINVSFNKMLVPGCPITVIINGGTTGPQVSLGGPGPLHLPNSLIINHAGGRLEDIEVNVE
GPSGHSVPAQVLQTADGVFKAEFVPRVVGEHRVSVTVEGQPTVGSPYSAKMSPLKNIAWA
AIGGGECSKDAMTGDMSWHVKVKGGFWEPPSRLLDQKVR
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctaaccactagaccagaacgacttgggtcaccgtggaatatcaacatcatgtcctcg
ccggggctgaccgcgctcggtgaatccacccggctggtgccggccaacgtgccggcggtt
tttgaagtgctgccgcctcctggggcctcgatccggggcagtgactgcgtcgcgacggtg
ctctcgcccagcaagagcaaggtcaacgcgcgcgtcacacacgaggcggccaacggggca
ctccggatcgagtttgtcccggccgaggtcggcacgcacattattgaggcctcgattggg
ggcaccacgttggtgggcgggccactcatcgccaaggtgtacgactcgagtctgatccag
gtgacggacgtcaacgggggagttgttgggcagccgtgccagttccgggtggatgccagc
gctgcgggcgagggtcagctggagatttccatcaacgagggagaagtgccgaaccacgtg
caggttgtgggtggtgggagatgtttagtttcgttcacaccggaacaggccaagccgcac
ctgatcgatatcaagttcaacggagaaaccgtcattggatgtccgttcgtgtgctccgtg
gccgacactagccgagttctgctcaacctgtccaacctggaactgattccggtaaaccga
cctgcctcgttccacatcacggtcagtggtggaggagcggccgagctggccgttagcgtt
cgtggaccccagggagaactgccggttcgcgtgaccggagatattcacgccggcttcacg
gctgaattcaccccgaaccacgtaggggcgcacacgatcaacgttgagtacaacggctac
cccgtacagggaacgcccttcgtggccaagtcgtacgacgcgaccaaggtagcggtcgga
tcagtgtccaagggcaccgttggcagaccggttcagttcaccgtcgatgccggagacgcc
ggcgaaggaaatctggagattacgatctccgccaaaggccataacatccccacccaggtg
cacccacaaggaaatgccaagttcgccgtctcgttcgtcccggcggaaccgtgcgagcac
atcatcaacgtcagcttcaacaagatgctcgtgccgggctgcccgatcacggtcatcatc
aacgggggaacgaccggaccgcaggtgtccctcgggggacccggtccgctccacttgccc
aattcgctaatcataaaccacgccggaggccgactggaggacatcgaggtcaacgtcgaa
ggaccgtccggccactcggtgccagcgcaggtcctgcagacggcggatggcgtgttcaag
gcggagtttgtgccgcgggtcgtcggagagcaccgcgtcagcgtgaccgtcgagggacaa
ccgacggtgggcagcccgtactcggcgaagatgtcgccgctaaagaacatcgcatgggcg
gccattgggggtggtgaatgttcgaaggatgcaatgacgggtgatatgagttggcacgtg
aaggttaaagggggcttctgggaaccaccatcgcgattgctggatcagaaagtccggtga

DBGET integrated database retrieval system