KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006592Help
Entry
CpipJ_CPIJ006592  CDS       T01079                                 

Definition
hypothetical protein
Orthology
K04437  
filamin
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CpipJ_CPIJ006592
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1159 aa AA seqDB search
MDLPKGAKITHAGLLQHTPDGKKEIQKITQAGLVARSPEGTAAKGMNIRGNEDLWVEIQA
NTFKNWVNEHLRESGMQVTDFHDDFCDGTYLCALVEGLQKRPLKPSWNKRPANQHHYLEN
ATTALNAIEADGVKLVNIGNVDIVNGNVKLILGLIWSLIVRYQIGRSKFPPRKLMLAWLQ
AALPDCKVSNLTSDWNSGVLLSALLDYCEPGLFPHWRTLDVHDSVRNCERAMNLAYERFG
IPKVLEPEYLASGWLDELSGMTYLSYFMKPDGPGYNATMRWVNSTIKRPVSNFTTDFNDG
KVFCEIIKDLGGPVPDPAKLSSDPIMWESNQNKVIEGGLKLGVKPVLSAKDMATADEEHL
GVMAYTTWLRWVIPRPPLADMFAVHLESTSGRVGEQTRFRVEVLSREVELSKVKAYVATP
NSNTMQPVKLNSKGEGSYVPDKYGMHEIVLEVDDNQLGGHFFRVLPRLVHVAPPGMAPCA
LGSLVEVLVNATGAPKSEDILVTAYSPSGRPLKCPLKKLDPGHSAIFKPDEAGVWEIAIT
YQGRHIQGGPFTCSVFDPCGVSVHGLDGAMPLRAHSFEVDARGVGVSGELHVDIVHEKRS
LVCSVEKLQENKYQVTFLPRQNGKHRVYIYFNGYDVKGSPYIMRVGSKGRSGKTRSSPSH
DNRMRSESPSYHFNSSSLNRKNESSLKREIYSPQTVQTTRETYSSRVTSPLRESPSPREI
QRSEFKNLSTDNIDYGFKKSTEMLASDFKTPPKDDAYNYVKTIRTENHVTKTIRSHRDSE
SPSLIRASPGLKSPQTVSSTIYETNSRNATASPKFFTSTTRYVPSPVDHRISSPINMHEK
NETYKVTERESSYKSTITRDVVRDSPTIDMYKTAPSAVDYSSNIRVTANNNGPSRRDSRD
VINKTKHMFSHNSLESLANLTEKQLNTDLTYDRAVDSQTEKNTHFNKFSLGENNHRPADR
KIIEDEGLYRPGGYLKNYKTESSSNERYEKYTTLNSGFEPIGRDVTGARAIRVQDIPDGV
LGRPVEFEIDGSQAGSGNLEILVNGGRVTSAVRALGNQRFIASFTPHESGVHTVQITFNE
ETVPAGPETTALLLKKRMRLGSELVDDGRNTEYVMMDRWRCLSAAGEKKFTAESDMTLVE
AFRPDVSWPLFDSDTDGES
NT seq 3480 nt NT seq  +upstreamnt  +downstreamnt
atggatctaccaaaaggagccaaaatcacacacgcaggtctgctgcagcacactcccgat
ggcaagaaggagatccagaagattacccaggccgggctggtcgcccggtcgccggagggg
actgcagcgaaagggatgaacatccggggcaacgaagatttgtgggtggagattcaggcg
aacacgttcaagaactgggtgaacgagcacctgcgggagtccgggatgcaggtcacggac
tttcacgacgatttctgcgacggaacgtacctgtgcgcgctggtcgagggccttcagaag
cgtccactgaagccgtcctggaacaagcgccccgccaatcagcaccactatctggagaac
gcgacgacggcgttgaacgccatcgaagcggacggggtgaagctagtcaacatcgggaac
gtggacatcgtcaatgggaacgtgaagctgattttggggctgatttggtcgctgatcgtg
cggtaccagatcggtcggagcaagttcccgccgaggaagctcatgttggcgtggctgcag
gccgcgcttccggactgtaaggtttctaatttgacgtcggattggaatagtggagtgctg
ctgtccgcgctgttggactactgcgagcccgggctgttcccgcactggcgaacgctggat
gttcacgattcggtgcggaactgcgagcgagcgatgaatctggcttatgaaaggttcgga
ataccgaaggtgctggagccggaatacctggcgtcgggttggctggacgaactgtccgga
atgacgtacttgtcgtactttatgaagcctgacggacctgggtacaacgcgaccatgcgg
tgggtcaacagtacaattaagcgacctgtgtccaacttcacgacggacttcaacgacgga
aaagtgttctgcgaaatcatcaaggatctgggcggacccgtgcccgacccggccaagttg
agctccgaccccatcatgtgggagagcaaccagaacaaggtcatcgagggtggcctgaag
ctgggcgtcaagcccgtcctgtccgccaaggacatggcaacggcggacgaggagcatctc
ggagtcatggcgtacaccacttggctgcgctgggtgatcccgagacctccgctggcggac
atgttcgccgttcatctggaaagcacttccggacgagttggcgagcagacccgtttccgg
gtggaggtgctctcgcgggaggttgagctgtccaaggtgaaggcgtacgttgcgacgccg
aacagcaacacgatgcagccggtgaagttgaactcgaagggcgaaggctcgtacgtgccg
gacaagtacggaatgcacgagatcgtgctggaggttgatgataatcaattgggtggtcat
ttcttccgcgtgttgccgcgcctggtgcacgtggccccacccgggatggctccgtgcgcc
ctcggcagtcttgtcgaggtgctggttaacgctacgggtgcaccgaagtcggaggacatc
ctggtgacggcgtacagcccgtcggggcgtccgctgaagtgtccgcttaagaagctggac
ccgggacacagtgccatattcaagccggacgaggccggcgtctgggagattgccataacg
taccaggggcgccacatccagggcggaccgttcacgtgttccgtgttcgatccgtgcggc
gtgtcggtgcacggactggacggtgccatgccgctgcgggcgcactcgtttgaggtggac
gcccgcggggtcggggtgagcggggagctgcacgtggacattgtgcacgagaagcgctcg
ctcgtttgctcggtggagaagctgcaggagaacaagtaccaggtgacgtttctaccgcgg
cagaacgggaagcatcgcgtttacatctacttcaatgggtacgatgtgaagggatcaccg
tacattatgcgggttggaagtaagggtcgctcggggaagactagaagtagccctagtcac
gacaaccgaatgagatcggagagcccgtcgtatcatttcaacagctcttcgttgaacagg
aagaacgagtcttcgcttaagcgtgaaatttactctccgcagacggtccaaactaccagg
gagacgtacagtagccgtgttacgtctccgttacgcgagagtccttcgccgagggagatc
caacgcagcgagtttaagaatctatcgaccgacaatattgactatgggttcaagaagagc
acggaaatgttggcgagtgacttcaagactcccccgaaggacgacgcgtacaactacgtt
aaaactattcgtacggaaaatcacgtaacgaagacgatccgctcgcatcgcgactcggaa
agcccgagcctgatccgcgctagtccagggctgaagagtccgcagacggtgtcttcaacg
atctacgaaaccaactcaagaaatgctaccgctagtcccaagttcttcacttcaacgacc
cgttacgtcccgtccccggtagatcaccgcatctccagcccaatcaacatgcacgaaaag
aacgaaacgtacaaggtaaccgagcgtgagtcctcgtacaagagcaccatcacgcgcgac
gtagtccgcgatagtccaacgattgacatgtacaagaccgccccgtctgccgtagactac
tcgtccaacattcgggtgaccgcaaacaacaacggaccgtcgcgtcgtgacagccgcgac
gtaatcaacaaaaccaagcacatgttttcgcacaactcgctggaatcgctggccaatctg
accgagaagcaactcaacacggacctgacgtacgaccgcgccgtagacagccagaccgag
aagaacacgcactttaacaagttctcgctgggggagaacaaccaccgtcccgccgaccgc
aagatcatcgaagacgagggcttgtaccgtcccgggggttacctaaagaactacaaaacg
gaatcgtcgtcgaacgagcggtacgaaaagtacaccacgctgaacagcggcttcgagccg
atcgggcgggacgtcaccggggcgcgggcaatccgcgtccaggacatcccggacggcgta
ctcggcagaccggtggagtttgagatcgacggctcgcaggctggctcgggcaacctggag
attctggttaacggggggcgcgtcacgtcggccgtccgagccctcggcaatcagcgtttc
atcgcgagcttcacgccgcacgagtccggcgtgcacacggtgcagatcacgttcaacgag
gaaaccgtgcccgcgggaccagaaacgacagcacttttactcaagaagcgaatgcggctg
gggtcggaattggttgatgacggcaggaacaccgagtacgtcatgatggaccggtggcgg
tgtttgtccgcagcgggcgaaaaaaaattcaccgcggaaagtgacatgactttagtggag
gcgttccgaccggacgtttcctggccgctgtttgatagcgataccgacggggagagttag

DBGET integrated database retrieval system