KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006691Help
Entry
CpipJ_CPIJ006691  CDS       T01079                                 

Definition
insect replication protein a
Orthology
K10739  
replication factor A2
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:cqu03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:cqu03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:cqu03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cqu03440]
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:cqu03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 248 aa AA seqDB search
MNDSFGGGGFNASSAGGAKDENKAEGVLPLMVRHILESSEAGIQLFGFQYAMVTFVGIVR
HIDHSSTKVTYRVEDHTGQVDAHLWLEEGDNMNIPGVLINTYVRIVGSVRSQGGSKAVMI
FKIAQIDSPNEVTTHLLEVLNARYKGEAYAKSAGIAGGAREGGSGEGSASGGGFMDNEAN
SMGLSGKQLVVYKAIKSHMSDIGISRKELQSKFPHISPSEMQSITDYMTQEGIVYTSVDS
DHFLCVDS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatagcttcggcggcggcggcttcaacgcgtcctcggccggtggcgccaaggac
gagaacaaagcggagggcgttctgccgctgatggtgcgccacatcttggaatcgtccgag
gcgggcatccagctgtttggcttccagtacgccatggtcacgttcgtgggcatcgtgcgg
cacattgaccactcctcgacgaaggtcacgtaccgggtggaggaccacaccggccaggtc
gatgcgcacctctggctggaggaaggggacaacatgaacatcccgggggtcttgattaac
acgtacgtgcggattgttggttccgtgcgctcccagggcggctcgaaggcggtgatgatc
ttcaagattgcgcagatcgattcgccgaacgaggtgacgacgcacctgctggaggtgttg
aacgcccggtacaagggcgaagcgtacgccaagagtgccggaattgcgggaggggctcgg
gagggtggttccggagagggaagcgccagcggcggtggcttcatggacaacgaagcgaac
tcgatggggctgtccgggaagcagctggtcgtttacaaggccatcaagagtcacatgtcg
gacattggcatcagccgaaaggagctgcagtccaagttcccgcacattagcccgtcggag
atgcagagcatcaccgattacatgacccaggagggcatcgtgtacaccagcgtggactcg
gaccacttcctgtgcgttgattcgtaa

DBGET integrated database retrieval system