KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006836Help
Entry
CpipJ_CPIJ006836  CDS       T01079                                 

Definition
histone deacetylase Rpd3
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    CpipJ_CPIJ006836
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CpipJ_CPIJ006836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 489 aa AA seqDB search
MQSHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAD
EMTKFHSDDYIRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAV
KLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDG
VEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGRGKYYAVNIPLRDGMDDESYESIFV
PIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGG
YTIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMSNQNTTEYLEKI
KNRLFENLRMLPHAPGVQVQAIPEDAVNDESEDEDKVDKDERLPQTDKDKRIVPDNEFSD
SEDEGEGGRRDNRSYKGGARKRPRLEKEPKAEEAKDELEVKAETTADKEETTSTKAGEDS
KKETTATVA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgcaatctcacagcaagaagcgcgtttgctactactacgacagtgacatcggcaactat
tactatggccagggacatccgatgaagccgcaccggatacgtatgacgcacaacctgctg
ctcaactatgggctgtaccggaagatggagatatatagaccgcacaaggcaactgccgat
gaaatgaccaaattccactccgacgactacatccggttcctgcggtcaatccgcccagac
aacatgtccgagtataacaaacagatgcagcgattcaacgtcggcgaggattgtccggtg
tttgacgggttgtacgagttctgccagctgtccgccgggggttccgtggcggccgccgtc
aagctgaacaagcaagcgtccgagatctgcatcaactggggcggagggctgcatcacgcc
aaaaagtccgaagcgtccggcttctgctacgtgaacgacatcgtgctgggcatcctggaa
ctgctcaagtatcaccagcgcgtgctgtacatcgatatcgacgtgcaccacggcgacggg
gtggaggaggcgttctacacgacggaccgcgtcatgaccgtgagcttccacaagtacggc
gagtacttcccgggaacgggagatctgcgcgatattggtgccggcaggggaaagtactac
gcggtgaacattccgctgcgcgacggaatggacgacgagtcgtacgagtcgatctttgtg
ccgattatttcgaaggtcatggaaacgttccagccgtcggcggtggtgctccagtgcggt
gccgactccctgaccggcgaccggctcggctgcttcaacctgaccgtcaagggccacggc
aagtgcgtcgagtttgtgaaaaagtacaacctgccgttcctgatggtgggcggcggcggc
tacacgatccgcaacgtgtcccgctgctggacgtacgagacgtcggtggcgctgggctgc
gagatcgcgaacgagctgccgtacaacgactacttcgagtactttgggccggactttaag
ctgcacatcagcccgagcaacatgagcaaccagaacacgacggagtatctggagaagatc
aagaacaggctgttcgagaatctgcggatgttgccgcacgcgccgggcgtgcaggttcag
gccatcccggaggacgccgtgaacgatgagagcgaggacgaggacaaggtcgacaaggac
gaacggctgccgcagacggacaaggacaagcggatagtgccggacaacgagttttccgac
tcggaggacgagggcgagggcggccggcgggacaaccgctcgtacaagggtggcgcccgg
aagcgaccgcggctggagaaggaaccgaaagcggaggaagccaaggacgagctcgaagtg
aaagccgaaacgacggcggacaaagaggagaccaccagcaccaaagcgggcgaagactcg
aagaaggaaaccactgccactgttgcatga

DBGET integrated database retrieval system