KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ007009Help
Entry
CpipJ_CPIJ007009  CDS       T01079                                 

Definition
hypothetical protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1034 aa AA seqDB search
MIARRRRGRRRKPCPVRGPRSPPMGQRILEVAGATMELLDRLLTVAKFRLLAAVQLLAAM
LVKLWPRGRARSRAVLELCVQEGMVQDVEGEDSDDDGQQSAGKDQLPVPKRVLYARDNVQ
IGWKATGRKWQTGAGMTNVGNTCYLNSTLQALFHVPAIANWLISDVTHRERCDDSNGQGG
CIICAMAKTLLASQSQNQGAIKPYLVYSKLRLVCKHLVLGRQEDAHEFLRYLVEAMEKSY
LARFKNSKEFDQLTKETTPLNQILGGYLRSEVKCLSCQHISTTFQHFEDLLLDIRKANSI
EDALDVYFARERLEENQYKCEACKKRVAATKQFSLERAPFALCIQLKRFSMMGGKINKHV
ELRNRLDLSPYCKTGKLTYRLVSMVTHLGNTQHCGHYTAIGGTESGSYYVFDDSSVRPIS
MQNVTSTNAYIIFYELESVQNGIKSTASSTATSASYAASASATGSSSSGKQLLGSNSGAP
AGSTAASPLRVLGPSGQSGHNPLLPSKLENRPGFIGPVLPGQQQQQTPQEKAKKLANGLS
NHHIHFNDAEDDFGEPTSRLSPVSSTTSSLSSPSPNKQSRPTTLPSPKKPTPASPASVKN
RFGMTITTNGVSSTSSTSNGTSQKPSTSSASSSLTASTSAPTLPSMPKLCNSSAAAKNGE
SSGGTSSSVGLNGNIKSASTTALSNGHKAVRLVPYDDGDDDDDDEEEEQQQRRIGSNGHN
RVQQHDSDEDEERLHPSAGNPKSVAPDEEEDSSCSPKSPPVIKSKTGLWKVSDNRPGSSS
SSSSSANSSKNASPATSGNSSPANYQNHNGNATSTVTNGRNGPLASGYQTNGNGRQQQPY
QQQPYQGNAFNFNGYNRNGNANQSDVVNQLQKFSHRGYGAPVRSWNGQQTHMDRELALER
REDRKRQMEDDRETEMDRGRTKKVKTNFYQGNSNGGGYQQQQRDGGNPFQSYQNNQMNGG
GGGMNNNGNGNNNRKWNNNGYNGNGGQRQQKFCDSPTRNKTCTLEICASILGGLLYYASW
TTRGLIKFEMKIIS
NT seq 3105 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcccggcgacggcgcggtcgccgacgcaaaccctgtcccgtccgcggtccgcgg
tcacctccgatgggtcaacgcattctggaggtggccggggccacgatggaactgctggac
cggctgttgaccgtggccaagttccgactgctggcggcggtccagctgctggcagcgatg
ctggtcaaactgtggccgagggggagggcgaggtcgcgagcggttttggagttgtgtgta
caagaaggaatggttcaggatgttgaaggggaagacagtgatgatgatggtcaacagagc
gccgggaaggatcagctgccggtgccgaagcgagtgttgtacgcccgcgataatgtgcag
atcgggtggaaggccacgggtcggaagtggcagaccggggccggaatgaccaacgtcggg
aacacgtgctaccttaactcgacgctgcaggcgctgtttcacgttccggcgatcgccaac
tggctgatttcggatgtgacccatcgggagcggtgcgatgacagcaacgggcagggaggt
tgtataatctgcgccatggccaagacgttgctggcgtcgcagtcgcagaaccagggcgcc
atcaagccctacctggtgtactcaaagttgcggctggtgtgcaaacacttggtgctgggt
cgccaggaggatgcgcacgagttcctgcgctacctggtcgaggccatggaaaagagctac
ctggccaggttcaagaacagcaaggagtttgatcagctcacgaaggagaccaccccgcta
aatcagatcctcggcggttacctccggtcggaggtaaagtgtctctcctgtcagcacatc
tcgaccacgttccagcactttgaggatctgctgctggacatccggaaggccaactcgatc
gaggacgcgctggatgtgtactttgcgcgggaacgcctcgaggagaaccagtacaagtgc
gaggcgtgcaagaagcgggtcgcggccaccaagcagttctccctcgagcgagcccccttt
gcgctctgcatccagctgaagcggttctccatgatgggcggcaagatcaacaagcacgtc
gagctgcggaaccggttggacctgtcgccgtactgcaaaaccggcaagctcacctaccga
ctcgtgtcgatggtgacccacctgggaaacacccagcactgtggccactacaccgccatc
ggtggcaccgagtccggctcgtactacgtcttcgacgacagctcggtgcggccaatctcg
atgcagaacgtcaccagcaccaacgcctacatcatattctacgagctagaaagtgttcaa
aatggtatcaaaagcaccgccagcagcactgccacctcggcctcgtacgccgcttccgcc
agcgctacggggagtagttcctccggcaagcagctgctcgggagtaattccggcgccccc
gccggatccactgctgcgtcgcccctccgagttctggggcctagcggccagtctggccac
aaccctcttctcccgagcaagttggaaaaccggcccggctttattgggccagtgctgcct
gggcagcagcaacaacaaaccccgcaggagaaagccaaaaagctggctaacgggctaagc
aatcaccacattcacttcaacgacgcggaagacgactttggtgaaccgacctcgcgcctc
tcccccgtctcctcaaccacctcgtccctctccagcccctccccgaacaagcagtcccgc
ccaacgacgctcccaagccccaaaaaacccacccccgcaagcccagccagcgtcaagaac
cgcttcggcatgacgataaccacaaacggcgtcagttccaccagcagcacctccaacggt
acctcccaaaagccttctacttcttccgcgtcgtcgtcgttgacggcctcgacatccgct
cccacactgccatccatgcctaaactttgcaacagttctgcagcagcgaagaacggcgaa
agcagcggcggcacctcgagttcagtggggctcaacggcaacatcaagtcggcctccacg
acggccctcagcaacggtcacaaagcggttcggctagtcccgtacgatgacggcgacgac
gacgatgatgacgaggaggaggagcagcagcagcgtcggattggttccaacggtcacaac
cgagttcagcagcacgacagtgacgaagacgaggaacgattacacccgagcgcgggaaac
cctaaatcggtcgcccccgacgaggaggaggactcgtcctgctcgcccaagtccccgccc
gtcatcaagtccaaaacgggcctctggaaggtgagcgacaaccgcccgggcagcagcagc
agcagcagtagcagtgccaacagcagcaaaaacgcatccccggccacgtctggcaactcg
tcgccggccaactaccagaaccacaacgggaacgcgacgtcaaccgttacaaacggcaga
aacggcccactagcctccggctaccaaaccaacggaaacggccgccagcagcaaccgtac
caacagcaaccctaccagggcaacgcgttcaactttaacgggtacaaccgaaacggtaat
gccaaccagtcggacgtggtcaaccagctgcaaaagttttcccaccgcgggtacggggcg
ccggtgcgcagctggaacggccagcagacgcacatggatcgggagttggcgctggagcgg
cgcgaggaccgcaaacggcagatggaggacgaccgcgagacggaaatggaccgcggtcgg
acgaagaaggtcaagacgaacttttaccagggtaacagtaacggcggtggctaccagcag
cagcagcgggacggcggcaatccgttccagagctatcagaataatcagatgaacggaggt
ggtggaggcatgaacaataatggcaacggcaacaacaaccggaagtggaacaataatggc
tacaatgggaatggtgggcagaggcagcagaagttttgcgattctccaactagaaacaag
acttgtaccttggaaatttgtgcaagtattctcggaggacttttgtattatgcaagttgg
acaacaagaggtttgatcaagtttgagatgaaaatcatttcataa

DBGET integrated database retrieval system