KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ007153Help
Entry
CpipJ_CPIJ007153  CDS       T01079                                 

Definition
carbamoyl-phosphate synthase large chain
Orthology
K11540  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase / dihydroorotase [EC:6.3.5.5 2.1.3.2 3.5.2.3]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CpipJ_CPIJ007153
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CpipJ_CPIJ007153
Enzymes [BR:cqu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CpipJ_CPIJ007153
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.3  dihydroorotase
     CpipJ_CPIJ007153
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     CpipJ_CPIJ007153
Peptidases [BR:cqu01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   CpipJ_CPIJ007153
 Metallo Peptidases
  Family M38: beta-aspartyl dipeptidase family
   CpipJ_CPIJ007153
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 2213 aa AA seqDB search
MPASLVLEDGTIFHGDTFGAATNSDGEVVFQTGMVGYPESMTDPSYHGQILVLTYPLVGN
YGIPDEDLDERGLMLHFESNNKIWTSGLVVGEICEEPSHWRSKLTLSEWMKKHRVPGISG
VDTRALTKKIRENGTVLGKIVQGILSSPSGITFSNQNLRNLVAEVSLSKPTTYNPSGSPR
ICAIDCGLKLNQVRCFIKRGARVDVVPWNAKLNPTDFDGLFLSNGPGDPVMCKITVDNIR
QLLQEPVVKPIFGICLGHQLLSTAAGCRTFKMKYGNRGHNLPCIHKGTKRCFMTSQNHGF
AVDAEKLPAGWEELFTNINDQTNEGIVHGEKPYFSVQFHPEHTAGPEDLEVLFDVFLDAV
KEYKSGAATKTSVKEKLVESLRYTPKRPVDTVRPKKVLILGSGGLSIGQAGEFDYSGSQA
IKALKEEKIQTVLINPNIATVQTSKGLADKVYFLPLTPEYVEQVIKAERPGGILLTFGGQ
TALNCGIELEKAGIFQKYGVKIMGTPITSIIETEDRKIFADRVAEIGEKVAPSAAVYSVQ
EAIEAANKIGYPVMARAAFSLGGLGSGFASNQEELKVLAQHALAHSNQLIIDKSLKGWKE
VEYEVVRDVYDNCITVCNMENVDPLGIHTGESIVVAPSQTLSNREYNMLRSTAIKVIRHF
GVVGECNIQYALNPYSEEYYIIEVNARLSRSSALASKATGYPLAYVAAKLALAIPLPEIK
NSVTGVTTACFEPSLDYCVVKMPRWDLSKFTRVSKHIGSSMKSVGEVMAIGRKFEEAFQK
ALRMVDNVNGFDPYLKAVNEHELVQPTDKRMFVLAAALKAGYTVEKIYELTQIDRWFLRK
MKTIIDFTTRLEELSAVPGKAMLLEAKKIGFSDKQIAGLINTTELVVRMQRKETGVLPFV
KQIDTVAGEWPASTNYLYMTYNATENDIEFPGQYTMVIGSGVYRIGSSVEFDWCAVGCLR
ELRNLGRKTIMVNYNPETVSTDYDMCDRLYFEEISFEVVMDIYDVEQPEGIILSMGGQLP
NNIAMDLHRQQARILGTSPESVDGAENRFKFSRMLDRKGILQPRWKELTNLESAIEFCEH
VGYPCLVRPSYVLSGAAMNVAYSNQDLETYLKFASDVSKEHPVVISKFLVEAKEIDVDAV
AADGEILCMAVSEHVENAGVHSGDATLVTPPQDINQETLERIKEIVRHIAALLDVTGPFN
MQLIAKNNELKVIECNVRVSRSFPFVSKTLNHDFVAMATRVIVGLSVEPVDVLAGCGKVG
VKVPQFSFARLAGADVMLGVEMASTGEVACFGDNRYEAYLKAMMSTGFQIPKRAILLSIG
SFKHKMELLPCIRILHKMGYKLYASMGTGDFYSEHGVDVECVQWTFDAALSGGDENGGAG
ELRHLAEFLANKQFDMVINLPMRGGGARRVSSFMTHGYRTRRLAVDYSIPLVTDVKCTKL
LVEAMSRIGRAPVMKTHTDCMSSRAMVKLPGFIDVHVHLREPGATYKEDFDSGTAAALAG
GVTMICAMPNTTPPIVDRAAFELVQELAQKGARCDYALFVGASSTNYGTIGELAPHAAAL
KMYLNETFTTLKLTDMIVWQKHLSHWPKRAPLCVHAERQSTAAVILLASLVDRPIHICHV
ARKEEIMIIKAAKEKGIKITCEVCPHHLFLSTADLDRIGHGKGEVRPVLCSPEDQQALWD
NLDVIDVFATDHAPHTKQEKESENPPPGFPGLETILPLLLTAVNEGRLSLEDLIAKFYKN
PKRIFGLPEQPNTYVEVDFNEEWTIPESPPHSKARWTPFAGMKVKGRVHRVVLRGETQRA
RVHLKKPTVAPSVEKINGSLDGLDLLTLSKTLPDTTRHDFWENDGHTNDVFSKLLAGNES
KQLGVHFGEAPQNHPTSPLPRIRCDSTSNYGKDVLLPAASLTPKERTLSGKHVLSVSMFS
KEQLNEIFNVAQTMRARVTKDRPLDDLLRGKVMASVFYEVSTRTSCSFAAAMQRLGGRVI
YMDETSSSVKKGETLEDSILVMAGYSDVVVLRHPEPGAVSKAAHHCRKPLINAGDGIGEH
PTQALLDIFTIREEIGTVNGLTITMVGDLKHGRTVHSLARLLTLYNVNVRYVSPKSLGMP
EKITKLVEAKGISQKIYDNLEDAIAETDVLYMTRIQKERFDSEEEYKKCCGQLVLTPQLM
TRAKRRMIVMHPLPRVFEISKEIDIDPRAAYFRQAEYGMYIRMALLAMVLGKC
NT seq 6642 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcctctctcgtcctcgaagatggaaccatcttccacggggacacgttcggtgcc
gccaccaactcggacggcgaggtggtcttccagacggggatggtcggctacccggagtcg
atgaccgacccgtcctaccacggccagatcctggtgctgacgtacccgttggtgggaaac
tacggcattccggacgaggatctggacgagcgtggtttgatgttgcactttgagtccaac
aataagatctggacgtcggggctggtggttggggagatctgcgaggaaccgtcgcattgg
cgcagcaagctgaccctgtcggagtggatgaagaagcaccgggtgccggggatcagcggg
gttgacacgagggcactgacgaagaagattcgcgagaatggaacggtgctgggcaagatc
gtccaaggtatcctctccagcccttccggtatcacgttcagcaatcagaacttgcgcaac
ttggttgcggaggtatcgctgtcgaagccgaccacgtacaacccgtccggtagtccgagg
atctgtgcaatcgactgtggtcttaagctgaaccaggttcgttgcttcatcaagcgagga
gcccgcgttgacgtagttccgtggaatgccaagctgaacccgacggactttgatgggttg
ttcttgagcaacggacccggagacccggtcatgtgcaagatcacggttgacaacatccgt
cagctgttgcaggaaccggtagtgaagccgatcttcggcatctgtctgggtcatcagctg
ctatcgactgcggccggatgccgaaccttcaagatgaagtacggcaatcggggtcacaac
ctgccgtgtatccataagggaacgaaaaggtgctttatgacctcgcagaaccatgggttt
gctgttgatgctgagaagctcccggcgggctgggaggagctgttcaccaacattaacgat
caaaccaacgagggcatcgtacatggagagaagccgtactttagtgtgcagttccatccg
gagcatacggcgggacctgaagatctggaggtgctgtttgacgtgtttttggatgccgtg
aaggagtacaagtcaggtgccgctaccaagacatcggtgaaggagaagttggttgagagc
ttgcgatacacgccgaagcgtccggttgataccgttagaccgaagaaggtactgatcctc
gggtcgggtggcttgtcgatcggtcaagcgggagagtttgactattccgggtcgcaagcg
atcaaggcactcaaggaggaaaagatccagacggtgctgatcaacccgaacattgcgacc
gtgcagacctccaagggtctcgccgataaggtgtacttcctgccgctgactccggagtac
gttgagcaggtgatcaaggcggaacgcccgggtgggatcctgctgacgttcggtggtcaa
accgctctgaattgcggtattgagctggaaaaggctgggatctttcagaaatacggtgtt
aagatcatgggaacaccgatcacttcaatcatagagaccgaggatcgcaagatcttcgcg
gatcgtgtagcggaaatcggcgagaaggtagctccgtcagcggcggtgtactcggtgcag
gaagcaatcgaggccgctaacaagatcggatatccggtgatggcgagggcggccttttcg
cttgggggtctcgggtccggttttgcgagtaatcaggaagagttgaaggttcttgctcaa
cacgcactcgcgcactccaaccaattgatcatcgacaagtctctgaagggttggaaggaa
gttgagtacgaagtggttcgggatgtttacgacaactgcatcacggtgtgtaatatggag
aacgtggatccgctgggtattcataccggggagagtattgtagtagcaccgtcgcaaacg
ttgtccaaccgcgagtacaacatgctgcgatcgaccgcaatcaaggtcatcaggcacttt
ggggtggttggtgagtgtaatatccagtatgcgttgaacccgtactcggaggagtactac
atcatcgaggtcaacgccaggttgtcgagaagttctgccctcgccagtaaggcaaccggt
tacccgctagcttacgtcgcggccaagcttgcgctagcgatcccgctgccagagatcaag
aactccgtcactggcgtcacaaccgcatgcttcgagcccagcttggattactgcgtggtg
aagatgccccgctgggatctgtccaagtttacgcgtgtcagcaagcacatcggcagttcg
atgaagagcgttggcgaggttatggccatcggtcgcaagtttgaagaagccttccagaag
gctcttcgcatggtggataacgtgaacggtttcgatccgtacctgaaggcggtcaatgag
cacgagctggtgcagcccacggacaagcggatgtttgtgcttgcggcggcactcaaggcg
ggctacacggtggagaagatatacgagctgacacagatcgatcggtggttcctgcgcaag
atgaagacgatcatcgactttacgacccggttggaggagctgtctgcggttcctggcaaa
gcgatgctgctggaggcgaagaagatcggcttttcggacaaacagatcgccggattgatc
aatactaccgagctagtggttcgaatgcagcggaaggagactggagtgttgccgttcgtg
aagcagatcgatacggtggcgggggagtggccggcttcgacgaattacctgtacatgacg
tacaacgccaccgagaatgacattgaattcccggggcagtacacgatggtgatcgggtcg
ggggtttatcggattggcagttcagttgagttcgattggtgtgccgttggatgtttgcgg
gagttgcggaacctcggcaggaagacgatcatggtgaactacaatccggaaacggtcagt
accgattacgatatgtgcgatcggttgtactttgaggagatttcgtttgaagtggtgatg
gacatctacgacgtggaacaaccggaaggcatcatcctgtcgatgggcggtcagctaccg
aacaacatcgccatggatcttcaccgacagcaagcgagaatcctgggtacgtccccggaa
tcggtggacggtgctgagaatcgtttcaagttctcccgaatgctcgatcgcaaaggaatc
cttcaacctcgctggaaggagcttaccaacctggagtccgcgatcgagttctgcgagcat
gttggctacccctgcttggtccgtccttcgtacgtgctctcaggagccgccatgaacgtt
gcctactccaaccaagacctagaaacctatctcaagttcgcttcggacgtcagcaaggaa
caccccgttgtgatctccaagttcctcgttgaagccaaagagatcgacgtcgacgcagtc
gccgccgacggtgagatcctctgcatggccgtctccgaacacgttgaaaacgccggagtc
cactccggagacgccaccctggtaacccctccccaagacatcaaccaagaaacgctggaa
cgcatcaaggagatcgtccggcacattgcggccctgctggacgtaaccgggcccttcaac
atgcagctgatcgcgaagaataacgagctgaaggtgatcgaatgtaacgtgcgcgtgtca
cgatcctttccctttgtgtcgaagaccctcaaccatgactttgtcgcaatggcaacgcgc
gtgatcgtggggttaagcgtggaaccggtcgatgtgctggcgggctgtgggaaggtcggc
gtaaaggtgccgcagtttagctttgcgcggttggccggggcggatgttatgctgggtgtt
gagatggcatcaacaggggaggttgcctgcttcggggacaaccggtacgaggcgtacctg
aaggcgatgatgtcgaccggattccagattccgaagcgggcgattctacttagtattgga
agctttaagcacaaaatggaactgctaccgtgcatccgtatcctgcacaagatgggctac
aagctgtacgcgtcgatgggaaccggagacttctactcggagcatggagttgacgtggag
tgtgtccagtggacgttcgatgcggccctttccggaggggacgagaatggtggagctggg
gagttacgtcacctggcagagttcctggcgaacaagcagtttgatatggtgatcaatctg
ccgatgcgcggcggtggggcgcgtagggtcagctcgtttatgacccacgggtacaggacg
agaagattggccgtcgactactcaatccccctcgtaacggacgtcaagtgcaccaaactg
ctggtggaagcgatgagccgcatcggccgtgcccccgtcatgaagacccacaccgactgt
atgtcttcgcgggccatggtcaaactgcccggcttcatcgacgtccacgtacatctgcgc
gaacctggcgccacctacaaggaggactttgactccgggacggctgctgcacttgctggt
ggcgttacgatgatctgcgcgatgccaaacacgacaccgccgatcgttgatcgtgccgcg
ttcgagctggttcaggagttggcccagaagggggctcgctgtgattacgcgctgtttgtg
ggggcttcgtctactaattatggtacgatcggggagttggcaccgcatgcggccgcgttg
aagatgtacctaaatgagacgtttacgacgctgaagttgacggacatgatcgtgtggcag
aagcacttgtctcattggcctaaaagggcgccactttgcgttcatgcggaacgtcagtcg
acggcggcggtgatcttgctggcgtcgttggtcgatcgaccgatccacatctgtcacgtg
gcgcggaaggaggagatcatgatcatcaaggcggcgaaggagaaagggatcaagatcacg
tgtgaggtttgtccgcaccatctgtttctttctacggcggatcttgaccggattgggcat
ggaaaaggtgaggttaggccggtgctgtgcagtcctgaggatcagcaagccctgtgggac
aatctggacgtgatcgacgtgtttgctacggatcatgcgccgcataccaagcaggagaag
gagtcggagaatcctccacctgggttcccggggttggaaacgattctaccgctgctgttg
accgccgtcaacgaaggtcgcctctcgttggaggacctcatcgccaagttctacaaaaac
cctaagcggatctttgggctcccggaacagcctaacacctacgtggaggttgacttcaac
gaagagtggaccattccggagtccccaccgcactccaaagcacgctggacgccgtttgcc
ggcatgaaggtcaaaggccgcgtacaccgggtagttcttcgcggcgaaacccaacgtgcg
cgagtgcacctcaagaaaccgacggtggcgccgtccgttgagaagatcaacggatcgttg
gacgggcttgacctactgacgctgagcaagaccctgccggatacgacccgtcacgatttc
tgggaaaacgacgggcacaccaacgacgtgttctcgaagcttctcgccggcaacgagtcc
aagcaactcggagttcactttggggaagcccctcaaaaccatccaacttctcctcttccc
cgcatccgctgcgactccaccagcaactacggcaaggacgtcctccttccggccgctagc
ctaacaccgaaggagcgaaccctctccggaaagcacgtactcagcgtttcgatgttcagc
aaggagcagctcaacgagatcttcaacgtggcgcaaacgatgcgagctcgcgtaacgaaa
gatcgcccgcttgacgacctgctgcgcgggaaggtcatggcgtccgttttctacgaagtc
agcacgcggaccagctgcagcttcgcggcggccatgcaacgtctcggaggtcgcgttatt
tacatggacgaaacgagctcttccgtcaagaagggtgaaaccctggaggacagcatcctg
gtgatggccggctactcggacgtggtggtgctgcgacatccggaaccgggagcggtttcg
aaggcggcccaccactgccggaagccgctgatcaacgccggcgacggaatcggggaacat
cccacgcaagccctgctggacatcttcaccatcagggaggaaatcggaacggtcaacggg
ttgaccattaccatggtgggggatttgaagcatggccggacggtgcactcgttggcgcgc
ctgttgacgctgtacaacgttaacgtgcggtacgtcagcccgaagagtttgggcatgccg
gagaagattacgaagctggtcgaggcgaaggggatctcgcagaagatttacgacaacttg
gaagacgctattgctgaaacagatgtcctgtacatgactcgcatccagaaggaacgcttt
gactctgaggaagagtacaaaaagtgctgcggccagctcgtcctcaccccgcagctgatg
acccgcgcaaagcgccgcatgatcgtaatgcacccccttccacgagtgttcgaaatcagc
aaggagattgacatcgacccacgggcggcatacttccgccaggccgagtacggcatgtac
atccggatggcgctgctcgcgatggttctgggcaaatgctga

DBGET integrated database retrieval system