KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ007184Help
Entry
CpipJ_CPIJ007184  CDS       T01079                                 

Definition
seryl-tRNA synthetase
Orthology
K01875  
seryl-tRNA synthetase [EC:6.1.1.11]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    CpipJ_CPIJ007184
Enzymes [BR:cqu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     CpipJ_CPIJ007184
Amino acid related enzymes [BR:cqu01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   CpipJ_CPIJ007184
Transfer RNA biogenesis [BR:cqu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CpipJ_CPIJ007184
 Prokaryotic Type
    CpipJ_CPIJ007184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 442 aa AA seqDB search
MLAFKTLSVLKSFHLEQKLLTYARFVHHKFHLVKPSYNTDYLLNPANIPEIQHNIEHRKG
VGNIQLVHELNNRLRSLPANASEAEKSQLNDQLQAELRKIPNRTHPGVLQHGADPKVVRY
YNEKPSLGEGAKVFEFSEMTKKMNIFRMEKLGNFTGHKSYYLTGELAELEQALIRYALSK
LLARNFHLITVPDILPARIIESCGMSTHGERNQVYKLNYPHETLCLSGTSEMALAGYFAG
TVTEESRLPLKLTAVSRCFRAETSALHEEKGIYRVHQFTKVEMFSVCRPDQSEAMLEEFR
DIEVDLFDALGVHFQLLDMPACELGAPAYRKYDIEAWMPGRGMYGEISSCSDCTDYQARR
LGIQYRSGSDNSQLNYAHTVNGTACAIPRMLIALLENFQNKDYTITIPEPLRPFMRGKDK
ISRKKVLPELKLTKRLAQEEIC
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgttagcatttaaaactttatccgttctgaaatcattccacttggagcaaaaactactc
acctacgcccgtttcgtgcatcacaagtttcacctggtaaaaccgagctataacaccgat
tacctgctgaatccggccaacataccggaaatccagcacaacatcgagcaccgcaaagga
gtcggaaacattcaactggtccatgagttaaacaatagactgcgttcgcttcctgccaat
gcaagtgaggcagaaaaatcccaactaaatgatcaacttcaggcggagttgagaaaaatt
cccaaccgaacccatccgggcgtgctgcagcacggtgcggatcccaaagtggtgcggtac
tacaacgagaagccgtcgcttggcgagggggcaaaggtgtttgagttttccgagatgacc
aaaaaaatgaacatctttcggatggaaaagctgggcaactttaccggccacaagtcgtac
tatctaacgggcgagttggccgagctagagcaagccctcatccggtacgcgctctcaaaa
ctcctggcacgcaacttccacctaatcaccgtgccggacatcctgccggctcgcataatc
gaaagctgtggcatgagcacccacggcgaacgcaaccaggtgtacaaactcaactacccg
cacgaaacgctctgcctgtcgggcacttccgagatggctctggcgggatactttgctgga
actgttacggaggagtcgcgactgccgctcaagctgaccgccgtcagtcgttgcttccgg
gcggaaacttcggcgctgcacgaggagaaaggcatctaccgggtgcatcagttcaccaag
gttgagatgttctccgtgtgccggcccgaccagtcggaggcgatgctggaggagtttcgg
gacatcgaggtggatctgtttgacgcgctgggcgttcacttccagctgttggacatgccc
gcgtgcgagttgggtgcgcctgcttaccggaagtatgacatcgaggcgtggatgccgggc
agggggatgtacggggaaatttctagctgtagcgactgtacggattatcaggcgaggaga
ttgggaattcaatatcgctccggaagcgacaacagtcagctaaactatgctcacacggtc
aacggaacggcgtgcgcaatcccacgaatgttaattgccctgttggagaacttccaaaac
aaagactacaccataacgattccggaaccgttgcgacctttcatgcgagggaaggacaaa
atcagccgaaagaaagtgttgcccgaacttaagctaaccaaacgattggctcaggaggaa
atttgttaa

DBGET integrated database retrieval system