KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ007184Help
Entry
CpipJ_CPIJ007184  CDS       T01079                                 

Definition
seryl-tRNA synthetase
Orthology
K01875  
seryl-tRNA synthetase [EC:6.1.1.11]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Aminoacyl-tRNA biosynthesis
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:cqu00970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 442 aa AA seqDB search
MLAFKTLSVLKSFHLEQKLLTYARFVHHKFHLVKPSYNTDYLLNPANIPEIQHNIEHRKG
VGNIQLVHELNNRLRSLPANASEAEKSQLNDQLQAELRKIPNRTHPGVLQHGADPKVVRY
YNEKPSLGEGAKVFEFSEMTKKMNIFRMEKLGNFTGHKSYYLTGELAELEQALIRYALSK
LLARNFHLITVPDILPARIIESCGMSTHGERNQVYKLNYPHETLCLSGTSEMALAGYFAG
TVTEESRLPLKLTAVSRCFRAETSALHEEKGIYRVHQFTKVEMFSVCRPDQSEAMLEEFR
DIEVDLFDALGVHFQLLDMPACELGAPAYRKYDIEAWMPGRGMYGEISSCSDCTDYQARR
LGIQYRSGSDNSQLNYAHTVNGTACAIPRMLIALLENFQNKDYTITIPEPLRPFMRGKDK
ISRKKVLPELKLTKRLAQEEIC
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgttagcatttaaaactttatccgttctgaaatcattccacttggagcaaaaactactc
acctacgcccgtttcgtgcatcacaagtttcacctggtaaaaccgagctataacaccgat
tacctgctgaatccggccaacataccggaaatccagcacaacatcgagcaccgcaaagga
gtcggaaacattcaactggtccatgagttaaacaatagactgcgttcgcttcctgccaat
gcaagtgaggcagaaaaatcccaactaaatgatcaacttcaggcggagttgagaaaaatt
cccaaccgaacccatccgggcgtgctgcagcacggtgcggatcccaaagtggtgcggtac
tacaacgagaagccgtcgcttggcgagggggcaaaggtgtttgagttttccgagatgacc
aaaaaaatgaacatctttcggatggaaaagctgggcaactttaccggccacaagtcgtac
tatctaacgggcgagttggccgagctagagcaagccctcatccggtacgcgctctcaaaa
ctcctggcacgcaacttccacctaatcaccgtgccggacatcctgccggctcgcataatc
gaaagctgtggcatgagcacccacggcgaacgcaaccaggtgtacaaactcaactacccg
cacgaaacgctctgcctgtcgggcacttccgagatggctctggcgggatactttgctgga
actgttacggaggagtcgcgactgccgctcaagctgaccgccgtcagtcgttgcttccgg
gcggaaacttcggcgctgcacgaggagaaaggcatctaccgggtgcatcagttcaccaag
gttgagatgttctccgtgtgccggcccgaccagtcggaggcgatgctggaggagtttcgg
gacatcgaggtggatctgtttgacgcgctgggcgttcacttccagctgttggacatgccc
gcgtgcgagttgggtgcgcctgcttaccggaagtatgacatcgaggcgtggatgccgggc
agggggatgtacggggaaatttctagctgtagcgactgtacggattatcaggcgaggaga
ttgggaattcaatatcgctccggaagcgacaacagtcagctaaactatgctcacacggtc
aacggaacggcgtgcgcaatcccacgaatgttaattgccctgttggagaacttccaaaac
aaagactacaccataacgattccggaaccgttgcgacctttcatgcgagggaaggacaaa
atcagccgaaagaaagtgttgcccgaacttaagctaaccaaacgattggctcaggaggaa
atttgttaa

DBGET integrated database retrieval system